Clone LP01183 Report

Search the DGRC for LP01183

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:11
Well:83
Vector:pOT2
Associated Gene/TranscriptCG8661-RA
Protein status:LP01183.pep: gold
Preliminary Size:664
Sequenced Size:680

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8661 2002-01-01 Sim4 clustering to Release 2
CG8661 2002-05-18 Blastp of sequenced clone
CG8661 2003-01-01 Sim4 clustering to Release 3
CG8661 2008-04-29 Release 5.5 accounting
CG8661 2008-08-15 Release 5.9 accounting
CG8661 2008-12-18 5.12 accounting

Clone Sequence Records

LP01183.complete Sequence

680 bp (680 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118975

> LP01183.complete
CAACGACAGCATGAAGTATACCATTCTTATTTTGGCTTTGGGCCTGTTTT
GCGTAAATGCATTGGTGGCTCCTGTTCCCAGCGCCCTGGACTCTTCGTCA
GAACTGGACGATGTGACCGATGGTAGCTTGGAGGTGGAGGACTTTGGCGT
GCTGAGTACGACCTACAAATCCCTAAAGATCGCTCTGCGAAGCATCAAGG
GACTCAATTGCATAATCAAGTGGGTGGCGGGCATCAAGGACAGTGCGACC
CAATTTAACACGGACGTGGTCGTGTGCGGCGTCACCGCCAGCAAGGATGT
GACCAAATTGATCAACGCCAACAATAAGATCCTCAGCACTTGCAACGACC
TCATCAATCTGAGGTCCAACACTTGCCCCCAAACGGACGACGAGGAGACG
AAGGTCTCTGGCAGCTGCTTTGTTAAGACTCTGCGCAAGGTGTGGTCCCT
AAAGAAGCAAGTGGACAATGCCATCAAGCTGGCCAAGAAGATCCCGCAAA
CCGGTCCCAATGCCGTCGCCTGTGTCTCCGATGCCGTCAACACCCTGACC
ACCTACTACACCGCCTTTCCCCAGAACATCATCAGCTGCTCCAAGCTGAC
TTCTTAGGGGTTTAGTGCCCGCAATTGATTCGAGCATTCAATAAAAATCC
GTGTTATCACAAAAAAAAAAAAAAAAAAAA

LP01183.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG8661-RA 878 CG8661-RA 94..754 1..661 3305 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:10:19
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 17173208..17173813 660..55 2985 99.5 Minus
chrX 22417052 chrX 17173874..17173929 56..1 280 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:45:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:10:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17283761..17284369 661..53 3045 100 Minus
X 23542271 X 17284428..17284483 56..1 280 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:34:24
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 17291859..17292467 661..53 3045 100 Minus
X 23527363 X 17292526..17292581 56..1 280 100 Minus
Blast to na_te.dros performed on 2019-03-16 06:10:18 has no hits.

LP01183.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:11:22 Download gff for LP01183.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 17173208..17173815 53..660 99 <- Minus
chrX 17173878..17173929 1..52 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:32:48 Download gff for LP01183.complete
Subject Subject Range Query Range Percent Splice Strand
CG8661-RA 1..597 11..607 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:43:56 Download gff for LP01183.complete
Subject Subject Range Query Range Percent Splice Strand
CG8661-RA 1..597 11..607 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:16:05 Download gff for LP01183.complete
Subject Subject Range Query Range Percent Splice Strand
CG8661-RA 1..597 11..607 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:36:04 Download gff for LP01183.complete
Subject Subject Range Query Range Percent Splice Strand
CG8661-RA 1..597 11..607 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:16:39 Download gff for LP01183.complete
Subject Subject Range Query Range Percent Splice Strand
CG8661-RA 1..597 11..607 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:18:42 Download gff for LP01183.complete
Subject Subject Range Query Range Percent Splice Strand
CG8661-RA 1..660 1..660 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:43:56 Download gff for LP01183.complete
Subject Subject Range Query Range Percent Splice Strand
CG8661-RA 1..660 1..660 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:16:05 Download gff for LP01183.complete
Subject Subject Range Query Range Percent Splice Strand
CG8661-RA 18..677 1..660 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:36:05 Download gff for LP01183.complete
Subject Subject Range Query Range Percent Splice Strand
CG8661-RA 1..660 1..660 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:16:39 Download gff for LP01183.complete
Subject Subject Range Query Range Percent Splice Strand
CG8661-RA 18..677 1..660 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:22 Download gff for LP01183.complete
Subject Subject Range Query Range Percent Splice Strand
X 17283762..17284369 53..660 100 <- Minus
X 17284432..17284483 1..52 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:22 Download gff for LP01183.complete
Subject Subject Range Query Range Percent Splice Strand
X 17283762..17284369 53..660 100 <- Minus
X 17284432..17284483 1..52 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:22 Download gff for LP01183.complete
Subject Subject Range Query Range Percent Splice Strand
X 17283762..17284369 53..660 100 <- Minus
X 17284432..17284483 1..52 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:16:05 Download gff for LP01183.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17177795..17178402 53..660 100 <- Minus
arm_X 17178465..17178516 1..52 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:08:30 Download gff for LP01183.complete
Subject Subject Range Query Range Percent Splice Strand
X 17291860..17292467 53..660 100 <- Minus
X 17292530..17292581 1..52 100   Minus

LP01183.hyp Sequence

Translation from 0 to 606

> LP01183.hyp
NDSMKYTILILALGLFCVNALVAPVPSALDSSSELDDVTDGSLEVEDFGV
LSTTYKSLKIALRSIKGLNCIIKWVAGIKDSATQFNTDVVVCGVTASKDV
TKLINANNKILSTCNDLINLRSNTCPQTDDEETKVSGSCFVKTLRKVWSL
KKQVDNAIKLAKKIPQTGPNAVACVSDAVNTLTTYYTAFPQNIISCSKLT
S*

LP01183.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:19:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG8661-PA 198 CG8661-PA 1..198 4..201 1005 100 Plus
CG5107-PA 213 CG5107-PA 49..209 34..196 231 32.1 Plus
CG8664-PB 214 CG8664-PB 45..209 32..196 172 27.4 Plus
CG8664-PA 214 CG8664-PA 45..209 32..196 172 27.4 Plus

LP01183.pep Sequence

Translation from 10 to 606

> LP01183.pep
MKYTILILALGLFCVNALVAPVPSALDSSSELDDVTDGSLEVEDFGVLST
TYKSLKIALRSIKGLNCIIKWVAGIKDSATQFNTDVVVCGVTASKDVTKL
INANNKILSTCNDLINLRSNTCPQTDDEETKVSGSCFVKTLRKVWSLKKQ
VDNAIKLAKKIPQTGPNAVACVSDAVNTLTTYYTAFPQNIISCSKLTS*

LP01183.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22619-PA 190 GF22619-PA 14..190 15..198 572 60.8 Plus
Dana\GF17269-PA 215 GF17269-PA 38..214 24..195 214 30 Plus
Dana\GF17271-PA 212 GF17271-PA 56..208 40..193 214 32.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:09:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18188-PA 199 GG18188-PA 1..199 1..198 937 91.5 Plus
Dere\GG11410-PA 212 GG11410-PA 48..208 31..193 212 32.1 Plus
Dere\GG18190-PA 214 GG18190-PA 44..209 28..193 149 26.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:09:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12643-PA 208 GH12643-PA 1..207 1..198 500 51.9 Plus
Dgri\GH12068-PA 204 GH12068-PA 42..200 30..193 204 29.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG8661-PA 198 CG8661-PA 1..198 1..198 1005 100 Plus
CG5107-PA 213 CG5107-PA 49..209 31..193 231 32.1 Plus
CG8664-PB 214 CG8664-PB 45..209 29..193 172 27.4 Plus
CG8664-PA 214 CG8664-PA 45..209 29..193 172 27.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:09:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15040-PA 209 GI15040-PA 1..208 1..198 529 53.1 Plus
Dmoj\GI13194-PA 189 GI13194-PA 19..185 29..193 201 31 Plus
Dmoj\GI15559-PA 206 GI15559-PA 37..204 25..193 201 26.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:09:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19836-PA 200 GL19836-PA 1..200 1..198 578 58.7 Plus
Dper\GL19884-PA 208 GL19884-PA 51..204 40..193 173 29.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21242-PA 200 GA21242-PA 1..200 1..198 566 58.2 Plus
Dpse\GA28269-PA 208 GA28269-PA 51..204 40..193 169 29.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13323-PA 198 GM13323-PA 1..198 1..198 961 94.4 Plus
Dsec\GM10249-PA 210 GM10249-PA 46..206 31..193 205 31.5 Plus
Dsec\GM13324-PA 214 GM13324-PA 45..209 29..193 156 27.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15681-PA 198 GD15681-PA 1..198 1..198 964 95.5 Plus
Dsim\GD21222-PA 212 GD21222-PA 48..208 31..193 210 32.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15171-PA 204 GJ15171-PA 35..200 26..193 227 29.6 Plus
Dvir\GJ11817-PA 184 GJ11817-PA 32..180 41..193 198 30.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25127-PA 201 GK25127-PA 1..201 1..198 557 56.7 Plus
Dwil\GK19214-PA 216 GK19214-PA 53..213 37..194 259 33.5 Plus
Dwil\GK25811-PA 212 GK25811-PA 40..208 30..193 221 31.4 Plus
Dwil\GK23759-PA 201 GK23759-PA 8..197 3..193 182 26.4 Plus
Dwil\GK25812-PA 214 GK25812-PA 53..183 40..163 160 27.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15603-PA 198 GE15603-PA 1..198 1..198 944 91.9 Plus
Dyak\GE23606-PA 212 GE23606-PA 36..208 26..193 202 30.1 Plus
Dyak\GE15604-PA 219 GE15604-PA 45..214 29..193 149 26.6 Plus