Clone LP01241 Report

Search the DGRC for LP01241

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:12
Well:41
Vector:pOT2
Associated Gene/TranscriptCpr67Fa2-RA
Protein status:LP01241.pep: gold
Preliminary Size:536
Sequenced Size:557

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18349 2002-01-01 Sim4 clustering to Release 2
CG18349 2003-01-01 Sim4 clustering to Release 3
Cpr67Fa2 2008-04-29 Release 5.5 accounting
Cpr67Fa2 2008-08-15 Release 5.9 accounting
Cpr67Fa2 2008-12-18 5.12 accounting

Clone Sequence Records

LP01241.complete Sequence

557 bp assembled on 2006-11-09

GenBank Submission: AY118976

> LP01241.complete
CACGAACTCCTCCAAATCAGCCAATATGTTCCGCTACATGCTCGTCGCCT
CCGCCGTCCTGGCCTGCGCCTACGGTGCCGCCACCTACAACCAGGAAGCT
GGTGCCTACATCACCAAGATCGGCTCCGACATCCAGCCCGAGGGCAACTA
CAACTACCAGTACGAGACCAGCAACGGCATCGCCGCCCAGGAGTCCGGAA
TTGGTGGAAACCACGCCAACGGAGGCTTCTCGTGGTACTCGCCAGAGGGT
GAGCTCGTCCAGATCTCGTACGTGGCCGACGAGAACGGCTACCAGCCACA
GGGAGCTCTCCTGCCCACTCCTCCCCCAATCCCAGCTGCCATCCTTAGGA
GCTTGGAGTACATCCGTACCCATCCCCAGTATGTCGAGCAGGAGTACCGC
AGGCCCGCCCTCAAGAAGGTCTTTGGTTAATCGAAATCGGGACTAGAATG
TGCCAACATACATATGAAAAGCTTTATTACGAATCGTAAAAATGTAAATG
TAGAAATGAAATAAACGTCGAAGATGTAAAGAAAACAAAAAAAAAAAAAA
AAAAAAA

LP01241.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:49:06
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr67Fa2-RA 536 Cpr67Fa2-RA 1..536 1..536 2680 100 Plus
Cpr67Fa1-RA 666 Cpr67Fa1-RA 109..529 10..430 1835 95.7 Plus
Lcp4-RA 690 Lcp4-RA 264..335 274..345 225 87.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 10883062..10883560 34..536 2390 98.8 Plus
chr3L 24539361 chr3L 10881269..10881660 39..430 1780 96.9 Plus
chr2R 21145070 chr2R 4325503..4325574 274..345 225 87.5 Plus
chr2R 21145070 chr2R 4323295..4323366 274..345 210 86.1 Plus
chr3L 24539361 chr3L 7085869..7085937 311..379 180 84.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:45:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10892014..10892518 34..538 2510 99.8 Plus
3L 28110227 3L 10890219..10890610 39..430 1765 96.7 Plus
2R 25286936 2R 8437977..8438048 274..345 225 87.5 Plus
2R 25286936 2R 8435769..8435840 274..345 210 86.1 Plus
3L 28110227 3L 10891743..10891779 1..37 185 100 Plus
3L 28110227 3L 7093638..7093706 311..379 180 84.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 10885114..10885618 34..538 2510 99.8 Plus
3L 28103327 3L 10883319..10883710 39..430 1765 96.6 Plus
2R 25260384 2R 8439176..8439247 274..345 225 87.5 Plus
2R 25260384 2R 8436968..8437039 274..345 210 86.1 Plus
3L 28103327 3L 10884843..10884879 1..37 185 100 Plus
Blast to na_te.dros performed on 2019-03-15 18:20:58 has no hits.

LP01241.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:22:04 Download gff for LP01241.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 10882791..10882827 1..37 97 -> Plus
chr3L 10883066..10883560 38..536 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:32:52 Download gff for LP01241.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67Fa2-RA 1..405 26..430 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:44:01 Download gff for LP01241.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67Fa2-RA 1..405 26..430 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:59:33 Download gff for LP01241.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67Fa2-RA 1..405 26..430 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:24:44 Download gff for LP01241.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67Fa2-RA 1..405 26..430 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:58:49 Download gff for LP01241.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67Fa2-RA 1..405 26..430 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:51:54 Download gff for LP01241.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67Fa2-RA 1..536 1..536 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:44:01 Download gff for LP01241.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67Fa2-RA 1..536 1..536 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:59:33 Download gff for LP01241.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67Fa2-RA 30..565 1..536 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:24:44 Download gff for LP01241.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67Fa2-RA 1..536 1..536 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:58:49 Download gff for LP01241.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67Fa2-RA 30..565 1..536 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:22:04 Download gff for LP01241.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10891743..10891779 1..37 100 -> Plus
3L 10892018..10892516 38..536 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:22:04 Download gff for LP01241.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10891743..10891779 1..37 100 -> Plus
3L 10892018..10892516 38..536 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:22:04 Download gff for LP01241.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10891743..10891779 1..37 100 -> Plus
3L 10892018..10892516 38..536 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:59:33 Download gff for LP01241.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10884843..10884879 1..37 100 -> Plus
arm_3L 10885118..10885616 38..536 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:57:48 Download gff for LP01241.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10885118..10885616 38..536 100   Plus
3L 10884843..10884879 1..37 100 -> Plus

LP01241.hyp Sequence

Translation from 2 to 445

> LP01241.hyp
RTPPNQPICSATCSSPPPSWPAPTVPPPTTRKLVPTSPRSAPTSSPRATT
TTSTRPATASPPRSPELVETTPTEASRGTRQRVSSSRSRTWPTRTATSHR
ELSCPLLPQSQLPSLGAWSTSVPIPSMSSRSTAGPPSRRSLVNRNRD*

LP01241.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
Sgs1-PA 1286 CG3047-PA 350..491 2..135 151 34 Plus

LP01241.pep Sequence

Translation from 25 to 429

> LP01241.pep
MFRYMLVASAVLACAYGAATYNQEAGAYITKIGSDIQPEGNYNYQYETSN
GIAAQESGIGGNHANGGFSWYSPEGELVQISYVADENGYQPQGALLPTPP
PIPAAILRSLEYIRTHPQYVEQEYRRPALKKVFG*

LP01241.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:31:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10615-PA 140 GF10615-PA 1..131 1..131 426 77.9 Plus
Dana\GF10616-PA 140 GF10616-PA 1..131 1..131 420 77.1 Plus
Dana\GF24793-PA 181 GF24793-PA 4..128 5..124 299 49.6 Plus
Dana\GF10617-PA 121 GF10617-PA 1..114 1..117 295 49.6 Plus
Dana\GF10274-PA 119 GF10274-PA 26..116 27..117 281 64.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:31:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15456-PA 134 GG15456-PA 1..134 1..134 579 87.3 Plus
Dere\GG15458-PA 134 GG15458-PA 1..134 1..134 577 87.3 Plus
Dere\GG14999-PA 178 GG14999-PA 8..121 5..117 306 53.5 Plus
Dere\GG15459-PA 122 GG15459-PA 1..122 1..131 274 43.5 Plus
Dere\GG13245-PA 121 GG13245-PA 1..113 1..117 265 49.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:31:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15388-PA 153 GH15388-PA 1..119 1..121 378 70.5 Plus
Dgri\GH16084-PA 157 GH16084-PA 1..121 1..117 299 50.4 Plus
Dgri\GH15387-PA 126 GH15387-PA 1..124 2..126 288 54.4 Plus
Dgri\GH15299-PA 118 GH15299-PA 1..118 1..120 266 46.7 Plus
Dgri\GH16160-PA 120 GH16160-PA 1..113 1..117 263 48.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:19
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr67Fa2-PA 134 CG18349-PA 1..134 1..134 711 100 Plus
Cpr67Fa1-PA 134 CG7941-PA 1..134 1..134 704 97.8 Plus
Cpr65Ec-PA 127 CG8634-PA 1..117 1..118 336 54.2 Plus
Cpr65Eb-PA 179 CG8638-PA 8..122 5..118 313 53 Plus
Cpr67Fb-PA 122 CG18348-PA 1..122 1..131 297 48.1 Plus
Edg78E-PB 122 CG7673-PB 1..113 1..117 270 50 Plus
Edg78E-PA 122 CG7673-PA 1..113 1..117 270 50 Plus
Cpr78Cc-PA 119 CG7658-PA 8..116 6..117 264 53 Plus
Pcp-PA 184 CG3440-PA 8..124 6..124 258 47.1 Plus
Cpr65Ea-PA 127 CG8640-PA 1..112 1..117 252 46.2 Plus
Cpr49Ae-PA 134 CG8505-PA 4..129 2..117 250 44.1 Plus
Lcp2-PB 126 CG8697-PB 1..117 1..117 246 39.8 Plus
Lcp2-PA 126 CG8697-PA 1..117 1..117 246 39.8 Plus
Lcp4-PB 112 CG2044-PB 1..109 1..117 240 46.2 Plus
Lcp4-PA 112 CG2044-PA 1..109 1..117 240 46.2 Plus
Lcp1-PB 130 CG11650-PB 1..121 1..117 233 38.5 Plus
Lcp1-PA 130 CG11650-PA 1..121 1..117 233 38.5 Plus
Cpr49Aa-PB 144 CG30045-PB 39..129 35..117 231 50.5 Plus
Lcp3-PB 112 CG2043-PB 1..109 1..117 228 42.7 Plus
Lcp3-PA 112 CG2043-PA 1..109 1..117 228 42.7 Plus
Cpr65Az-PA 239 CG12330-PA 116..207 29..111 221 47.8 Plus
Cpr47Ef-PD 601 CG13214-PD 146..225 39..110 216 53.8 Plus
Cpr47Ef-PC 612 CG13214-PC 146..225 39..110 216 53.8 Plus
Cpr47Ea-PA 135 CG9079-PA 38..127 24..105 208 45.6 Plus
Cpr49Af-PB 126 CG8510-PB 27..126 34..131 203 38.7 Plus
Cpr49Af-PA 126 CG8510-PA 27..126 34..131 203 38.7 Plus
Cpr78Ca-PA 127 CG11310-PA 42..126 38..126 187 47.2 Plus
Cpr78Cb-PB 140 CG7663-PB 47..130 34..118 183 47.1 Plus
Cpr78Cb-PA 140 CG7663-PA 47..130 34..118 183 47.1 Plus
Cpr47Eg-PA 117 CG9070-PA 8..114 13..117 182 41.8 Plus
Cpr49Ah-PA 190 CG8515-PA 53..146 29..113 166 38.3 Plus
Lcp65Ad-PB 108 CG6955-PB 3..106 2..99 163 35.8 Plus
Lcp65Ad-PA 108 CG6955-PA 3..106 2..99 163 35.8 Plus
Cpr65Ax2-PB 102 CG18777-PB 2..100 3..100 156 36.8 Plus
Cpr65Ax2-PA 102 CG18777-PA 2..100 3..100 156 36.8 Plus
Cpr65Ax1-PA 102 CG34270-PA 2..100 3..100 156 36.8 Plus
Lcp65Ac-PA 109 CG6956-PA 7..106 6..100 154 35.9 Plus
Lcp65Af-PA 100 CG10533-PA 2..100 3..102 153 37 Plus
Cpr49Ab-PA 259 CG30042-PA 149..254 17..116 153 33.6 Plus
Lcp65Ag2-PA 105 CG10534-PA 2..103 3..100 150 34.9 Plus
Lcp65Ag1-PA 105 CG10530-PA 2..103 3..100 150 34.9 Plus
Cpr11B-PB 195 CG2555-PB 58..155 17..105 148 32.7 Plus
Cpr11B-PA 197 CG2555-PA 58..155 17..105 148 32.7 Plus
Lcp65Ag3-PA 105 CG18779-PA 2..103 3..100 147 34 Plus
Cpr65Av-PA 111 CG32405-PA 9..109 5..97 144 32.7 Plus
Cpr100A-PA 241 CG12045-PA 1..126 1..128 141 29.7 Plus
Cpr49Ac-PE 285 CG8502-PE 129..208 35..113 141 32.5 Plus
Acp65Aa-PA 105 CG10297-PA 1..104 1..97 140 30.5 Plus
Lcp65Ab1-PA 104 CG32400-PA 2..102 3..100 139 35.5 Plus
Lcp65Ab2-PA 104 CG18773-PA 2..102 3..100 139 35.5 Plus
Lcp65Ae-PA 99 CG10529-PA 19..96 27..97 136 39.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12994-PA 134 GI12994-PA 1..117 1..121 346 62 Plus
Dmoj\GI12346-PA 108 GI12346-PA 7..108 24..131 285 52.8 Plus
Dmoj\GI12347-PA 159 GI12347-PA 25..122 18..118 279 51.5 Plus
Dmoj\GI12993-PA 126 GI12993-PA 1..115 2..117 271 56 Plus
Dmoj\GI20906-PA 117 GI20906-PA 1..112 1..117 268 47.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21882-PA 147 GL21882-PA 1..117 1..117 377 82.1 Plus
Dper\GL24679-PA 120 GL24679-PA 1..116 1..117 286 48.7 Plus
Dper\GL25022-PA 129 GL25022-PA 4..124 2..126 286 57.6 Plus
Dper\GL11748-PA 122 GL11748-PA 1..114 1..117 283 47.9 Plus
Dper\GL24678-PA 119 GL24678-PA 1..116 1..117 274 48.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14900-PA 147 GA14900-PA 1..117 1..117 377 82.1 Plus
Dpse\GA23698-PA 190 GA23698-PA 22..130 11..122 315 53.6 Plus
Dpse\GA21228-PA 183 GA21228-PA 22..126 11..118 314 54.6 Plus
Dpse\GA20507-PA 120 GA20507-PA 1..116 1..117 286 48.7 Plus
Dpse\GA14899-PA 122 GA14899-PA 1..114 1..117 283 47.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25233-PA 134 GM25233-PA 1..134 1..134 597 95.5 Plus
Dsec\GM25232-PA 134 GM25232-PA 1..134 1..134 594 94.8 Plus
Dsec\GM13790-PA 179 GM13790-PA 8..122 5..118 306 53 Plus
Dsec\GM25234-PA 122 GM25234-PA 1..122 1..131 295 48.1 Plus
Dsec\GM14815-PA 127 GM14815-PA 1..122 1..126 265 54 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:32:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14265-PA 134 GD14265-PA 1..134 1..134 678 96.3 Plus
Dsim\GD14264-PA 134 GD14264-PA 1..134 1..134 586 94 Plus
Dsim\GD14266-PA 116 GD14266-PA 1..116 1..116 437 74.1 Plus
Dsim\GD13091-PA 179 GD13091-PA 8..122 5..118 306 53 Plus
Dsim\GD13990-PA 127 GD13990-PA 1..122 1..126 265 54 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:32:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13137-PA 139 GJ13137-PA 1..118 1..121 433 68 Plus
Dvir\GJ12238-PA 160 GJ12238-PA 1..122 1..118 296 46.4 Plus
Dvir\GJ20634-PA 126 GJ20634-PA 1..126 1..126 289 44.9 Plus
Dvir\GJ13136-PA 127 GJ13136-PA 1..117 1..118 283 55.1 Plus
Dvir\GJ20637-PA 117 GJ20637-PA 1..117 1..122 273 47.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:32:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17778-PA 140 GK17778-PA 1..120 1..122 362 68.5 Plus
Dwil\GK16649-PA 134 GK16649-PA 29..128 24..126 335 61.2 Plus
Dwil\GK17540-PA 191 GK17540-PA 1..123 1..118 319 51.2 Plus
Dwil\GK20466-PA 121 GK20466-PA 2..121 1..121 296 50.4 Plus
Dwil\GK17780-PA 112 GK17780-PA 11..112 24..131 259 49.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:32:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21769-PA 134 GE21769-PA 1..134 1..134 569 85.8 Plus
Dyak\GE21768-PA 134 GE21768-PA 1..134 1..134 493 86.6 Plus
Dyak\GE20445-PA 172 GE20445-PA 8..123 5..118 298 53.4 Plus
Dyak\GE21770-PA 122 GE21770-PA 1..122 1..131 296 48.9 Plus
Dyak\GE21591-PA 127 GE21591-PA 1..122 1..126 265 54 Plus