Clone LP01332 Report

Search the DGRC for LP01332

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:13
Well:32
Vector:pOT2
Associated Gene/TranscriptCG1239-RA
Protein status:LP01332.pep: gold
Preliminary Size:1156
Sequenced Size:1041

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1239 2001-01-01 Release 2 assignment
CG1239 2003-01-01 Sim4 clustering to Release 3
CG1239 2003-01-15 Blastp of sequenced clone
CG1239 2008-04-29 Release 5.5 accounting
CG1239 2008-08-15 Release 5.9 accounting
CG1239 2008-12-18 5.12 accounting

Clone Sequence Records

LP01332.complete Sequence

1041 bp (1041 high quality bases) assembled on 2003-01-15

GenBank Submission: AY061533

> LP01332.complete
ATGTGGTAAACATTTTAATTTGTATGTTTTTAAAGATATAAAAGGGCAAG
GGCATAAACTCATTGATATATATGTAATTTCACAATGGATTTGGAGAACA
ACAACAATACGCCATTGACCGGCAAACAAGCCGAAAAATGTGCGAAAAAG
CGAAAATGTGTAATAACATTAGATGAAAAGCAAGTGGAATCCAAAAGACT
GAAAAAGGAGGAATCAAATGTGGAGGCCACAAGCCGTCCGCCTGCGCAGA
GTCCCAAAAAACGGCTCCATCTAAACGGAAAGCCCATGCAAAACAAGGAC
CTTAACTTCAAGTACGGCAACTATAAGCACTACTACGGCAAGCGCATCCT
GAACAAGGATTTTCACGACATACGCCTGGACGTGCTTGGCACGCAACCGG
ATTTGTTTCGGAACAAGCAGCTGCTTGACATCGGCTGCAACTCTGGCCAC
CTGTCCATCCAGATTGCCAGGAAATTCGAGGTTAAGAGCCTCGTGGGCCT
GGACATAGATCGGGGGCTAATAAATGATGCCCAAAAAACCGTCAGTCACC
TGAAACGTCACGCAACCCCGGGGCAGGGGATACCCCACATACAGTTTGTG
CACGGGAACTACGTCCTGGAGGACGACGTCCTGCTCGAAATTGAACGGCC
GCAGTTCGACGTCATACTCTGCCTGTCTGTCACTAAGTGGATCCACCTTA
ATTTCTGTGATTCCGGCCTGAAGCAGGCCTTCAGACGCATGTACCTGCAG
CTGCGCCCGGGCGGCAAGCTGATCCTGGAACCTCAGTCCTTCGACGGCTA
CAAGAGGCGCAAGAAGCTATCGGAACAAATAAGAGATAACTACAATGCAA
TTAAATTCCGACCTGATCATTTCACCGAATATCTGCTTAGCCCGGAAGTG
GGCTTTGCCGAAATGAAACTTATGGGCATACCGGAGCACTGCAAAGTAGG
ATTCAAGCGACCGATCCAAATTTTTACAAAGTCGTAGGAAATAAAAAGAA
AATCAAGAAATGAAAATTATCTGAAAAAAAAAAAAAAAAAA

LP01332.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:44:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG1239-RA 1040 CG1239-RA 18..1040 1..1023 5115 100 Plus
CG1239.a 1020 CG1239.a 94..1020 97..1023 4635 100 Plus
CG1239.a 1020 CG1239.a 18..94 1..77 385 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:13:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1559334..1560080 77..823 3735 100 Plus
chr3R 27901430 chr3R 1560148..1560349 822..1023 1010 100 Plus
chr3R 27901430 chr3R 1559188..1559263 1..76 380 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:45:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5733687..5734433 77..823 3735 100 Plus
3R 32079331 3R 5734501..5734706 822..1027 1030 100 Plus
3R 32079331 3R 5733541..5733616 1..76 380 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5474518..5475264 77..823 3735 100 Plus
3R 31820162 3R 5475332..5475537 822..1027 1030 100 Plus
3R 31820162 3R 5474372..5474447 1..76 380 100 Plus
Blast to na_te.dros performed 2019-03-16 11:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 6391..6465 82..5 121 67.1 Minus

LP01332.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:13:57 Download gff for LP01332.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1559188..1559263 1..76 100 -> Plus
chr3R 1559334..1560079 77..822 100 -> Plus
chr3R 1560149..1560349 823..1023 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:32:55 Download gff for LP01332.complete
Subject Subject Range Query Range Percent Splice Strand
CG1239-RA 1..903 85..987 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:38:42 Download gff for LP01332.complete
Subject Subject Range Query Range Percent Splice Strand
CG1239-RA 1..903 85..987 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:06:12 Download gff for LP01332.complete
Subject Subject Range Query Range Percent Splice Strand
CG1239-RA 1..903 85..987 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:15:33 Download gff for LP01332.complete
Subject Subject Range Query Range Percent Splice Strand
CG1239-RA 1..903 85..987 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:30:36 Download gff for LP01332.complete
Subject Subject Range Query Range Percent Splice Strand
CG1239-RA 1..903 85..987 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:43:11 Download gff for LP01332.complete
Subject Subject Range Query Range Percent Splice Strand
CG1239-RA 1..1023 1..1023 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:38:42 Download gff for LP01332.complete
Subject Subject Range Query Range Percent Splice Strand
CG1239-RA 1..1023 1..1023 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:06:12 Download gff for LP01332.complete
Subject Subject Range Query Range Percent Splice Strand
CG1239-RA 29..1051 1..1023 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:15:34 Download gff for LP01332.complete
Subject Subject Range Query Range Percent Splice Strand
CG1239-RA 1..1023 1..1023 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:30:36 Download gff for LP01332.complete
Subject Subject Range Query Range Percent Splice Strand
CG1239-RA 29..1051 1..1023 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:13:57 Download gff for LP01332.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5733541..5733616 1..76 100 -> Plus
3R 5733687..5734432 77..822 100 -> Plus
3R 5734502..5734702 823..1023 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:13:57 Download gff for LP01332.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5733541..5733616 1..76 100 -> Plus
3R 5733687..5734432 77..822 100 -> Plus
3R 5734502..5734702 823..1023 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:13:57 Download gff for LP01332.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5733541..5733616 1..76 100 -> Plus
3R 5733687..5734432 77..822 100 -> Plus
3R 5734502..5734702 823..1023 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:06:12 Download gff for LP01332.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1559263..1559338 1..76 100 -> Plus
arm_3R 1559409..1560154 77..822 100 -> Plus
arm_3R 1560224..1560424 823..1023 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:51:29 Download gff for LP01332.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5474518..5475263 77..822 100 -> Plus
3R 5475333..5475533 823..1023 100   Plus
3R 5474372..5474447 1..76 100 -> Plus

LP01332.pep Sequence

Translation from 84 to 986

> LP01332.pep
MDLENNNNTPLTGKQAEKCAKKRKCVITLDEKQVESKRLKKEESNVEATS
RPPAQSPKKRLHLNGKPMQNKDLNFKYGNYKHYYGKRILNKDFHDIRLDV
LGTQPDLFRNKQLLDIGCNSGHLSIQIARKFEVKSLVGLDIDRGLINDAQ
KTVSHLKRHATPGQGIPHIQFVHGNYVLEDDVLLEIERPQFDVILCLSVT
KWIHLNFCDSGLKQAFRRMYLQLRPGGKLILEPQSFDGYKRRKKLSEQIR
DNYNAIKFRPDHFTEYLLSPEVGFAEMKLMGIPEHCKVGFKRPIQIFTKS
*

LP01332.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16344-PA 317 GF16344-PA 1..305 1..299 1125 72.5 Plus
Dana\GF11051-PA 1396 GF11051-PA 1002..1141 160..299 402 53.6 Plus
Dana\GF11051-PA 1396 GF11051-PA 789..884 63..158 195 42.3 Plus
Dana\GF18849-PA 235 GF18849-PA 12..201 76..261 156 29.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13000-PA 298 GG13000-PA 1..298 1..300 1406 88 Plus
Dere\GG23201-PA 1371 GG23201-PA 988..1116 171..299 407 57.4 Plus
Dere\GG23201-PA 1371 GG23201-PA 780..867 73..161 199 43.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17289-PA 320 GH17289-PA 1..319 1..299 1059 64.1 Plus
Dgri\GH20938-PA 1624 GH20938-PA 1233..1361 171..299 402 55.8 Plus
Dgri\GH20938-PA 1624 GH20938-PA 953..1033 73..154 197 42.7 Plus
Dgri\GH15816-PA 243 GH15816-PA 12..209 76..261 166 31.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG1239-PC 300 CG1239-PC 1..300 1..300 1589 100 Plus
CG1239-PB 300 CG1239-PB 1..300 1..300 1589 100 Plus
CG1239-PA 300 CG1239-PA 1..300 1..300 1589 100 Plus
bin3-PD 1367 CG8276-PD 981..1112 168..299 399 56.1 Plus
bin3-PA 1367 CG8276-PA 981..1112 168..299 399 56.1 Plus
bin3-PB 1367 CG8276-PB 981..1112 168..299 399 56.1 Plus
bin3-PC 1367 CG8276-PC 981..1112 168..299 399 56.1 Plus
bin3-PD 1367 CG8276-PD 785..865 73..154 195 45.1 Plus
bin3-PA 1367 CG8276-PA 785..865 73..154 195 45.1 Plus
bin3-PB 1367 CG8276-PB 785..865 73..154 195 45.1 Plus
bin3-PC 1367 CG8276-PC 785..865 73..154 195 45.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23870-PA 315 GI23870-PA 1..314 1..299 1032 64.6 Plus
Dmoj\GI18374-PA 1566 GI18374-PA 1176..1304 171..299 407 56.6 Plus
Dmoj\GI18374-PA 1566 GI18374-PA 946..1038 61..154 205 43.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:57:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24517-PA 195 GL24517-PA 1..184 1..189 612 65.1 Plus
Dper\GL20337-PA 1458 GL20337-PA 1076..1204 171..299 395 55 Plus
Dper\GL24518-PA 54 GL24518-PA 1..53 247..299 243 83 Plus
Dper\GL20337-PA 1458 GL20337-PA 845..925 73..154 196 43.9 Plus
Dper\GL17955-PA 235 GL17955-PA 12..201 76..261 152 27.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:57:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11602-PA 304 GA11602-PA 1..303 1..299 1209 75.4 Plus
Dpse\GA20948-PA 1522 GA20948-PA 1140..1268 171..299 396 55 Plus
Dpse\GA26118-PA 1531 GA26118-PA 1145..1273 171..299 396 55 Plus
Dpse\GA20948-PA 1522 GA20948-PA 914..994 73..154 197 43.9 Plus
Dpse\GA26118-PA 1531 GA26118-PA 914..994 73..154 197 43.9 Plus
Dpse\GA10934-PA 235 GA10934-PA 12..201 76..261 151 29.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10834-PA 395 GM10834-PA 96..395 1..300 1515 94.3 Plus
Dsec\GM16541-PA 1365 GM16541-PA 982..1110 171..299 407 57.4 Plus
Dsec\GM16541-PA 1365 GM16541-PA 784..868 73..158 198 44.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19815-PA 306 GD19815-PA 1..306 1..300 1494 92.2 Plus
Dsim\GD10403-PA 1368 GD10403-PA 985..1113 171..299 407 57.4 Plus
Dsim\GD10403-PA 1368 GD10403-PA 786..870 73..158 198 44.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:57:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23960-PA 332 GJ23960-PA 1..331 1..299 1065 63.4 Plus
Dvir\GJ21451-PA 1553 GJ21451-PA 1171..1299 171..299 392 55 Plus
Dvir\GJ21451-PA 1553 GJ21451-PA 929..1013 73..158 203 46.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:57:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13208-PA 310 GK13208-PA 1..303 1..299 1119 70.1 Plus
Dwil\GK19498-PA 1549 GK19498-PA 1128..1278 149..299 411 51 Plus
Dwil\GK19498-PA 1549 GK19498-PA 931..1011 73..154 211 46.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:57:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10158-PA 299 GE10158-PA 1..299 1..300 1410 87.7 Plus
Dyak\GE20781-PA 1369 GE20781-PA 986..1114 171..299 401 56.6 Plus
Dyak\GE20781-PA 1369 GE20781-PA 781..868 73..161 199 43.8 Plus

LP01332.hyp Sequence

Translation from 84 to 986

> LP01332.hyp
MDLENNNNTPLTGKQAEKCAKKRKCVITLDEKQVESKRLKKEESNVEATS
RPPAQSPKKRLHLNGKPMQNKDLNFKYGNYKHYYGKRILNKDFHDIRLDV
LGTQPDLFRNKQLLDIGCNSGHLSIQIARKFEVKSLVGLDIDRGLINDAQ
KTVSHLKRHATPGQGIPHIQFVHGNYVLEDDVLLEIERPQFDVILCLSVT
KWIHLNFCDSGLKQAFRRMYLQLRPGGKLILEPQSFDGYKRRKKLSEQIR
DNYNAIKFRPDHFTEYLLSPEVGFAEMKLMGIPEHCKVGFKRPIQIFTKS
*

LP01332.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:47:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG1239-PC 300 CG1239-PC 1..300 1..300 1589 100 Plus
CG1239-PB 300 CG1239-PB 1..300 1..300 1589 100 Plus
CG1239-PA 300 CG1239-PA 1..300 1..300 1589 100 Plus
bin3-PD 1367 CG8276-PD 981..1112 168..299 399 56.1 Plus
bin3-PA 1367 CG8276-PA 981..1112 168..299 399 56.1 Plus
bin3-PD 1367 CG8276-PD 785..865 73..154 195 45.1 Plus