Clone LP01585 Report

Search the DGRC for LP01585

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:15
Well:85
Vector:pOT2
Associated Gene/TranscriptCG11454-RA
Protein status:LP01585.pep: validated not full length
Preliminary Size:995
Sequenced Size:859

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11454 2001-01-01 Release 2 assignment
CG11454 2001-10-10 Blastp of sequenced clone
CG11454 2008-04-29 Release 5.5 accounting
CG11454 2008-08-15 Release 5.9 accounting
CG11454 2008-12-18 5.12 accounting

Clone Sequence Records

LP01585.complete Sequence

859 bp (859 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061534

> LP01585.complete
CAGTTACTAATGCAGCAAATGTATAGTGGTGCGTCGGTCATGACGATTTC
GGAAACGAACATAGATGGTTACAGATACGGTATTCCATCTGGCCAGCACC
AAGAGCAGCCAATTTACCCTTTCCTGCCCAATGAAAACGGTGACCAGTTG
GTTGGGCAACTGGAGGACGACGACGATGAGGAGGAGGACGAGGAGCAACG
GACTCTGTTCTGCGGGAATCTCGACGAGCGCGTGACGGAGGAGATCCTTT
ACGAGGTGTTCCTGCAAGCTGGCCCCATCGAAGGAGTGCGGATACCGACC
GATAACAATGGGCGTCCCCGGAATTTCGGGTTTGTCACATACCAACGCCT
GTGTGCGGTGCCTTTTGCCCTAGACTTGTACCAGGGCCTTGAACTGTTCC
AAAAGAAAGTCACCATCAAGCAGCAGGGCGGCAAGCAGCTACCTGCCTAC
AACCAAAGTCGTCTGCGCAATCAGTTCATGATGGAGGCTCTACCGCAGCC
ATCGCCACTGCGTCACGCCCGACACAGTTTGCATAACGGCAAGCCGTACG
ATCGCAATCCTTTTGGACACAACGCCGATCAACGGCGCCGGAGCGACAGC
TCCGTAATGGAACGCAACCGGCTAAAACCACAGCAACACCACCAGCACAT
GCAGGGAGGCAGCAGAAGATCGGACCAACGCTCCAACAACAAACGCAGAT
TGCTTTAAGATTTCACCACATTTTCGTCTTTATGTATACCCTAGTCCTTC
AGTTACTCAAAACCAAAATCAAAAGTTACCGTCTTTAATCGTTTAATGAG
CTGGATATCTGCAGAAAATTATGTATCAAATGAAGCAGTTTAAAAAAAAA
AAAAAAAAA

LP01585.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG11454-RA 919 CG11454-RA 79..919 1..841 4205 100 Plus
CG11454.a 812 CG11454.a 74..812 103..841 3695 100 Plus
CG11454.a 812 CG11454.a 47..74 1..28 140 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:13:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 143424..144264 1..841 4205 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:46:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:13:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 143387..144228 1..842 4210 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 143387..144228 1..842 4210 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:13:31 has no hits.

LP01585.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:14:13 Download gff for LP01585.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 143424..144264 1..841 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:33:08 Download gff for LP01585.complete
Subject Subject Range Query Range Percent Splice Strand
CG11454-RA 10..717 1..708 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:38:12 Download gff for LP01585.complete
Subject Subject Range Query Range Percent Splice Strand
CG11454-RA 10..717 1..708 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:56:20 Download gff for LP01585.complete
Subject Subject Range Query Range Percent Splice Strand
CG11454-RA 10..717 1..708 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:19:01 Download gff for LP01585.complete
Subject Subject Range Query Range Percent Splice Strand
CG11454-RA 10..717 1..708 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:29:53 Download gff for LP01585.complete
Subject Subject Range Query Range Percent Splice Strand
CG11454-RA 10..717 1..708 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:34:41 Download gff for LP01585.complete
Subject Subject Range Query Range Percent Splice Strand
CG11454-RA 12..852 1..841 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:38:12 Download gff for LP01585.complete
Subject Subject Range Query Range Percent Splice Strand
CG11454-RA 79..919 1..841 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:56:20 Download gff for LP01585.complete
Subject Subject Range Query Range Percent Splice Strand
CG11454-RA 65..905 1..841 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:19:01 Download gff for LP01585.complete
Subject Subject Range Query Range Percent Splice Strand
CG11454-RA 12..852 1..841 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:29:53 Download gff for LP01585.complete
Subject Subject Range Query Range Percent Splice Strand
CG11454-RA 65..905 1..841 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:14:13 Download gff for LP01585.complete
Subject Subject Range Query Range Percent Splice Strand
2L 143387..144227 1..841 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:14:13 Download gff for LP01585.complete
Subject Subject Range Query Range Percent Splice Strand
2L 143387..144227 1..841 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:14:13 Download gff for LP01585.complete
Subject Subject Range Query Range Percent Splice Strand
2L 143387..144227 1..841 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:56:20 Download gff for LP01585.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 143387..144227 1..841 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:43:11 Download gff for LP01585.complete
Subject Subject Range Query Range Percent Splice Strand
2L 143387..144227 1..841 100   Plus

LP01585.pep Sequence

Translation from 0 to 707

> LP01585.pep
QLLMQQMYSGASVMTISETNIDGYRYGIPSGQHQEQPIYPFLPNENGDQL
VGQLEDDDDEEEDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPT
DNNGRPRNFGFVTYQRLCAVPFALDLYQGLELFQKKVTIKQQGGKQLPAY
NQSRLRNQFMMEALPQPSPLRHARHSLHNGKPYDRNPFGHNADQRRRSDS
SVMERNRLKPQQHHQHMQGGSRRSDQRSNNKRRLL*

LP01585.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:16:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14865-PA 241 GF14865-PA 4..241 1..234 609 59.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:16:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24699-PA 238 GG24699-PA 4..238 1..235 1000 85.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:16:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10062-PA 251 GH10062-PA 76..251 67..235 468 60.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG11454-PA 238 CG11454-PA 4..238 1..235 1251 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16471-PA 252 GI16471-PA 40..252 23..235 458 51.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13956-PA 238 GL13956-PA 4..238 1..235 568 58.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11013-PA 238 GA11013-PA 4..238 1..235 573 58.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16717-PA 237 GM16717-PA 4..237 1..235 1072 91.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23003-PA 238 GD23003-PA 4..238 1..235 1070 91.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:17:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16219-PA 249 GJ16219-PA 72..249 65..235 462 58 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:17:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24608-PA 255 GK24608-PA 79..255 67..234 467 59.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:17:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16604-PA 240 GE16604-PA 4..240 1..235 958 83.5 Plus

LP01585.hyp Sequence

Translation from 0 to 707

> LP01585.hyp
QLLMQQMYSGASVMTISETNIDGYRYGIPSGQHQEQPIYPFLPNENGDQL
VGQLEDDDDEEEDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPT
DNNGRPRNFGFVTYQRLCAVPFALDLYQGLELFQKKVTIKQQGGKQLPAY
NQSRLRNQFMMEALPQPSPLRHARHSLHNGKPYDRNPFGHNADQRRRSDS
SVMERNRLKPQQHHQHMQGGSRRSDQRSNNKRRLL*

LP01585.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:35:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG11454-PA 238 CG11454-PA 4..238 1..235 1251 100 Plus