Clone LP01642 Report

Search the DGRC for LP01642

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:16
Well:42
Vector:pOT2
Associated Gene/TranscriptCG2444-RA
Protein status:LP01642.pep: gold
Preliminary Size:635
Sequenced Size:651

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2444 2002-01-01 Sim4 clustering to Release 2
CG2444 2002-05-18 Blastp of sequenced clone
CG2444 2003-01-01 Sim4 clustering to Release 3
CG2444 2008-04-29 Release 5.5 accounting
CG2444 2008-08-15 Release 5.9 accounting
CG2444 2008-12-18 5.12 accounting

Clone Sequence Records

LP01642.complete Sequence

651 bp (651 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118977

> LP01642.complete
CCAGCATCCCAGTTGATAACACCTCGCTCGATCCCAGAGTTTCCACCAGA
GATTACCCAAAACGAAATCCAGTATCGAGCAGTATGTCGCAGTTTAGCAC
CGTTGCCGCATTCCTACTCCTCGGCCTGGTCGTCATCCTTGGCGGCCACG
TTGGCCAGGCGGCCGTTGCCAAGGTCAAACTGAACAATTCATCGCATCCC
GGCAAGTGTGTGCTGGACACGAACACGATCCTGTCGCCCGGGGAGACGGG
TCTGGCGCCGGATCTGCCATGCGTGCGGGCCGAATGCCATGCGGATGGCT
TGGTGACCTTCAAAACCTGCGATGCAGTCGCTCCGCCACCGGGCTGCAAG
CAGCGCGACTTTGTGAACATCAATCGCGAATTTCCCGCTTGCTGCGAGCG
GAAATACAATTGCGACAAGCACATCTAACATCTTAAGCCATTATTAATTG
CCATAATCCTTAAGTTGCTCAACTAACTAGGAGGCAATGGGCAATGGATT
TGTTTTCAGCTTATTATTTCGTTCTTTTTTTTTTTTTTTGTTTGTTTTTA
TTTATTGTGTATACTACAACATAACAATTAAAATGTAAACGCTTAGCAAT
ACAATTAAATAATTTAATAGAATCAAAAAAAAAAAAAAAAAAAAAAAAAA
A

LP01642.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG2444-RA 819 CG2444-RA 185..809 1..625 3125 100 Plus
PhKgamma.d 2747 PhKgamma.d 2645..2747 625..523 515 100 Minus
PhKgamma-RB 2427 PhKgamma-RB 2342..2427 625..540 430 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:32:56
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11595509..11595941 624..193 2100 99.5 Minus
chrX 22417052 chrX 11596020..11596211 192..1 960 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:46:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11704309..11704741 625..193 2165 100 Minus
X 23542271 X 11704820..11705011 192..1 960 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11712407..11712839 625..193 2165 100 Minus
X 23527363 X 11712918..11713109 192..1 960 100 Minus
Blast to na_te.dros performed 2019-03-15 22:32:55
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker2 7672 Stalker2 STALKER2 7672bp 1297..1386 617..521 134 66 Minus

LP01642.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:33:45 Download gff for LP01642.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11596020..11596211 1..192 100   Minus
chrX 11595509..11595576 557..624 100 == Minus
chrX 11595636..11595941 193..498 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:33:12 Download gff for LP01642.complete
Subject Subject Range Query Range Percent Splice Strand
CG2444-RA 1..345 84..428 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:43:57 Download gff for LP01642.complete
Subject Subject Range Query Range Percent Splice Strand
CG2444-RA 1..345 84..428 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:24:28 Download gff for LP01642.complete
Subject Subject Range Query Range Percent Splice Strand
CG2444-RA 1..345 84..428 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:36:06 Download gff for LP01642.complete
Subject Subject Range Query Range Percent Splice Strand
CG2444-RA 1..345 84..428 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:27:25 Download gff for LP01642.complete
Subject Subject Range Query Range Percent Splice Strand
CG2444-RA 1..345 84..428 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:18:44 Download gff for LP01642.complete
Subject Subject Range Query Range Percent Splice Strand
CG2444-RA 1..624 1..624 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:43:57 Download gff for LP01642.complete
Subject Subject Range Query Range Percent Splice Strand
CG2444-RA 1..624 1..624 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:24:28 Download gff for LP01642.complete
Subject Subject Range Query Range Percent Splice Strand
CG2444-RA 15..638 1..624 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:36:06 Download gff for LP01642.complete
Subject Subject Range Query Range Percent Splice Strand
CG2444-RA 1..624 1..624 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:27:25 Download gff for LP01642.complete
Subject Subject Range Query Range Percent Splice Strand
CG2444-RA 15..638 1..624 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:45 Download gff for LP01642.complete
Subject Subject Range Query Range Percent Splice Strand
X 11704820..11705011 1..192 100   Minus
X 11704310..11704741 193..624 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:45 Download gff for LP01642.complete
Subject Subject Range Query Range Percent Splice Strand
X 11704820..11705011 1..192 100   Minus
X 11704310..11704741 193..624 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:45 Download gff for LP01642.complete
Subject Subject Range Query Range Percent Splice Strand
X 11704820..11705011 1..192 100   Minus
X 11704310..11704741 193..624 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:24:28 Download gff for LP01642.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11598343..11598774 193..624 100 <- Minus
arm_X 11598853..11599044 1..192 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:08:31 Download gff for LP01642.complete
Subject Subject Range Query Range Percent Splice Strand
X 11712408..11712839 193..624 100 <- Minus
X 11712918..11713109 1..192 100   Minus

LP01642.hyp Sequence

Translation from 2 to 427

> LP01642.hyp
SIPVDNTSLDPRVSTRDYPKRNPVSSSMSQFSTVAAFLLLGLVVILGGHV
GQAAVAKVKLNNSSHPGKCVLDTNTILSPGETGLAPDLPCVRAECHADGL
VTFKTCDAVAPPPGCKQRDFVNINREFPACCERKYNCDKHI*

LP01642.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG2444-PB 114 CG2444-PB 1..114 28..141 616 100 Plus
CG2444-PA 114 CG2444-PA 1..114 28..141 616 100 Plus
CG34178-PC 112 CG34178-PC 8..112 37..138 146 32.4 Plus
CG34178-PB 112 CG34178-PB 8..112 37..138 146 32.4 Plus
CG34178-PA 112 CG34178-PA 8..112 37..138 146 32.4 Plus

LP01642.pep Sequence

Translation from 83 to 427

> LP01642.pep
MSQFSTVAAFLLLGLVVILGGHVGQAAVAKVKLNNSSHPGKCVLDTNTIL
SPGETGLAPDLPCVRAECHADGLVTFKTCDAVAPPPGCKQRDFVNINREF
PACCERKYNCDKHI*

LP01642.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21439-PA 114 GF21439-PA 1..114 1..114 379 60.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18842-PA 113 GG18842-PA 1..113 1..114 477 80.7 Plus
Dere\GG25002-PA 107 GG25002-PA 5..107 8..111 143 30.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24561-PA 114 GH24561-PA 1..114 1..114 323 54.8 Plus
Dgri\GH10127-PA 109 GH10127-PA 23..109 25..112 152 35.2 Plus
Dgri\GH11662-PA 111 GH11662-PA 11..104 7..110 151 37.5 Plus
Dgri\GH10126-PA 193 GH10126-PA 115..193 37..112 141 39.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG2444-PB 114 CG2444-PB 1..114 1..114 616 100 Plus
CG2444-PA 114 CG2444-PA 1..114 1..114 616 100 Plus
CG34178-PC 112 CG34178-PC 8..112 10..111 146 32.4 Plus
CG34178-PB 112 CG34178-PB 8..112 10..111 146 32.4 Plus
CG34178-PA 112 CG34178-PA 8..112 10..111 146 32.4 Plus
CG34215-PA 104 CG34215-PA 6..100 11..107 136 32 Plus
CG34177-PA 107 CG34177-PA 33..107 37..111 136 30.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16321-PA 114 GI16321-PA 1..114 1..114 261 43.9 Plus
Dmoj\GI22128-PA 112 GI22128-PA 25..107 25..107 162 37.3 Plus
Dmoj\GI22106-PA 175 GI22106-PA 93..170 37..114 154 34.6 Plus
Dmoj\GI22117-PA 109 GI22117-PA 30..108 35..110 134 34.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:10:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15237-PA 112 GL15237-PA 1..108 1..110 323 56.4 Plus
Dper\GL15154-PA 187 GL15154-PA 84..187 11..111 148 30.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:10:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15367-PA 112 GA15367-PA 1..108 1..110 326 57.3 Plus
Dpse\GA25544-PA 187 GA25544-PA 86..187 15..111 147 31.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:10:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13054-PA 114 GM13054-PA 1..114 1..114 492 95.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:10:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15980-PA 114 GD15980-PA 1..114 1..114 495 95.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:10:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15661-PA 122 GJ15661-PA 10..122 1..114 295 49.1 Plus
Dvir\GJ19996-PA 111 GJ19996-PA 24..111 25..112 179 40.9 Plus
Dvir\GJ17737-PA 111 GJ17737-PA 9..104 12..110 160 39.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:10:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19793-PA 115 GK19793-PA 3..115 5..114 298 50.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:10:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17607-PA 115 GE17607-PA 19..115 18..114 461 87.6 Plus