Clone LP01886 Report

Search the DGRC for LP01886

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:18
Well:86
Vector:pOT2
Associated Gene/TranscriptCG4367-RA
Protein status:LP01886.pep: gold
Preliminary Size:692
Sequenced Size:848

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4367 2002-01-01 Sim4 clustering to Release 2
CG4367 2002-05-18 Blastp of sequenced clone
CG4367 2003-01-01 Sim4 clustering to Release 3
CG4367 2008-04-29 Release 5.5 accounting
CG4367 2008-08-15 Release 5.9 accounting
CG4367 2008-12-18 5.12 accounting

Clone Sequence Records

LP01886.complete Sequence

848 bp (848 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118980

> LP01886.complete
TGAATACGTATAAATTTATCCTGTTTCTTAGCATGGGTTTTTTAAACCGG
ATGGGTGAACTGGAGGGCCACGGTATGATGTTAAGTCCAACCGGAAGATC
CTCGCGTTGGCGCTACGATAACTCGGCGCCAACAAACTACGATGACAATG
CATTATATTGCGGTGGATTTTGGAAACAAACCGAAAATGATGGCAAATGT
GGACTGTGCGGAGACGACTGGAGCTTGGAGCAGCCGCGACCCAATGAGTT
GGGTGGAAAATATGGCAGTGGAGTGATTGTAAAGAGCTTTGCCGGAGTAG
ATGAAGCGGAAATTAATGTTAAGATCACAGCCAATCATCTGGGCTACTTC
CGCTTCCACATCTGCGATTTGGACGAAAATGGCAGCGAGTCGGAGGATTG
CTTTAACCAATATCCTTTGAATTTCACCGACGGTAGCCAGAAGTACTACA
TTAACACCACCACTGGCGATATCCCAGTAACCGTGAAACTGCCCAGTGAT
CTCAACTGCATTCATTGCGTTTTGCGCTGGACTTACACGGCGGGAAATAA
TTGGGGTGTTTGTGAGGATGGGACGGGCGCCATGGGTTGTGGGGCGCAGG
AAACCTTTATTAACTGCGCTGATATCAGTGTACTATCCTCAGCGAGAAGT
ATTATCCAGGAGGTGCCCGTGGAGGTGGCGGAATCGAAGTGAGGTGGTTA
TCATCAGCGGTGGCCAATCGAACAATACTGCTAGTCTCAATAAATTATGT
AACTTATTTATTTCTAATTGTTCCAAATTGTTCATCAACAATACGATTTT
GTTTTAAGAAAAGGTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LP01886.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:46:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG4367-RA 1037 CG4367-RA 102..918 1..817 4085 100 Plus
CG4367.a 1287 CG4367.a 19..835 1..817 4085 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16128050..16128697 816..169 3225 99.8 Minus
chr3R 27901430 chr3R 16128755..16128927 173..1 835 98.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:46:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:46:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20304077..20304725 817..169 3230 99.8 Minus
3R 32079331 3R 20304782..20304954 173..1 865 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20044908..20045556 817..169 3230 99.8 Minus
3R 31820162 3R 20045613..20045785 173..1 865 100 Minus
Blast to na_te.dros performed on 2019-03-16 20:46:11 has no hits.

LP01886.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:47:17 Download gff for LP01886.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16128050..16128692 174..816 100 <- Minus
chr3R 16128755..16128927 1..173 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:33:27 Download gff for LP01886.complete
Subject Subject Range Query Range Percent Splice Strand
CG4367-RA 1..660 33..692 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:40:26 Download gff for LP01886.complete
Subject Subject Range Query Range Percent Splice Strand
CG4367-RA 1..660 33..692 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:27:50 Download gff for LP01886.complete
Subject Subject Range Query Range Percent Splice Strand
CG4367-RA 1..660 33..692 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:18:25 Download gff for LP01886.complete
Subject Subject Range Query Range Percent Splice Strand
CG4367-RA 1..660 33..692 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:52:59 Download gff for LP01886.complete
Subject Subject Range Query Range Percent Splice Strand
CG4367-RA 1..660 33..692 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:45:57 Download gff for LP01886.complete
Subject Subject Range Query Range Percent Splice Strand
CG4367-RA 1..816 1..816 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:40:26 Download gff for LP01886.complete
Subject Subject Range Query Range Percent Splice Strand
CG4367-RA 1..816 1..816 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:27:50 Download gff for LP01886.complete
Subject Subject Range Query Range Percent Splice Strand
CG4367-RA 1..816 1..816 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:18:26 Download gff for LP01886.complete
Subject Subject Range Query Range Percent Splice Strand
CG4367-RA 1..816 1..816 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:52:59 Download gff for LP01886.complete
Subject Subject Range Query Range Percent Splice Strand
CG4367-RA 1..816 1..816 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:47:17 Download gff for LP01886.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20304078..20304720 174..816 100 <- Minus
3R 20304782..20304954 1..173 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:47:17 Download gff for LP01886.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20304078..20304720 174..816 100 <- Minus
3R 20304782..20304954 1..173 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:47:17 Download gff for LP01886.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20304078..20304720 174..816 100 <- Minus
3R 20304782..20304954 1..173 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:27:50 Download gff for LP01886.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16129800..16130442 174..816 100 <- Minus
arm_3R 16130504..16130676 1..173 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:53:30 Download gff for LP01886.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20044909..20045551 174..816 100 <- Minus
3R 20045613..20045785 1..173 100   Minus

LP01886.hyp Sequence

Translation from 2 to 691

> LP01886.hyp
NTYKFILFLSMGFLNRMGELEGHGMMLSPTGRSSRWRYDNSAPTNYDDNA
LYCGGFWKQTENDGKCGLCGDDWSLEQPRPNELGGKYGSGVIVKSFAGVD
EAEINVKITANHLGYFRFHICDLDENGSESEDCFNQYPLNFTDGSQKYYI
NTTTGDIPVTVKLPSDLNCIHCVLRWTYTAGNNWGVCEDGTGAMGCGAQE
TFINCADISVLSSARSIIQEVPVEVAESK*

LP01886.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG4367-PB 219 CG4367-PB 1..219 11..229 1211 100 Plus
CG4367-PA 219 CG4367-PA 1..219 11..229 1211 100 Plus
CG4362-PA 233 CG4362-PA 2..233 4..226 642 50.6 Plus
CG42598-PB 340 CG42598-PB 29..224 22..210 452 42 Plus
CG42749-PB 285 CG15786-PA 29..231 17..213 447 39.4 Plus

LP01886.pep Sequence

Translation from 32 to 691

> LP01886.pep
MGFLNRMGELEGHGMMLSPTGRSSRWRYDNSAPTNYDDNALYCGGFWKQT
ENDGKCGLCGDDWSLEQPRPNELGGKYGSGVIVKSFAGVDEAEINVKITA
NHLGYFRFHICDLDENGSESEDCFNQYPLNFTDGSQKYYINTTTGDIPVT
VKLPSDLNCIHCVLRWTYTAGNNWGVCEDGTGAMGCGAQETFINCADISV
LSSARSIIQEVPVEVAESK*

LP01886.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:12:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17331-PA 230 GF17331-PA 18..228 7..217 994 83.9 Plus
Dana\GF17787-PA 233 GF17787-PA 15..231 7..217 610 53.7 Plus
Dana\GF21331-PA 234 GF21331-PA 2..185 26..203 406 41.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:12:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15565-PA 230 GG15565-PA 12..229 1..218 1100 93.1 Plus
Dere\GG15554-PA 233 GG15554-PA 15..233 7..216 625 54.5 Plus
Dere\GG18746-PA 284 GG18746-PA 31..230 10..203 439 39.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:12:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23904-PA 231 GH23904-PA 17..226 7..216 841 69 Plus
Dgri\GH23898-PA 210 GH23898-PA 15..209 7..200 647 57.9 Plus
Dgri\GH19593-PA 370 GH19593-PA 22..230 11..214 474 43.3 Plus
Dgri\GH24606-PA 281 GH24606-PA 33..230 12..203 456 41.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG4367-PD 230 CG4367-PD 12..230 1..219 1211 100 Plus
CG4367-PC 230 CG4367-PC 12..230 1..219 1211 100 Plus
CG4362-PA 233 CG4362-PA 17..233 9..216 635 53.2 Plus
CG42598-PB 340 CG42598-PB 29..224 12..200 452 42 Plus
CG42749-PB 285 CG15786-PA 29..231 7..203 447 39.4 Plus
CG42749-PC 345 CG42749-PC 29..231 7..203 447 39.4 Plus
CG42749-PD 345 CG42749-PD 29..231 7..203 447 39.4 Plus
CG41284-PC 340 CG41284-PC 29..224 12..200 446 41.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:12:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10048-PA 245 GI10048-PA 22..234 9..219 845 71.8 Plus
Dmoj\GI23986-PA 373 GI23986-PA 35..240 11..209 464 42.9 Plus
Dmoj\GI15275-PA 244 GI15275-PA 1..193 17..203 430 41.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:12:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12511-PA 229 GL12511-PA 18..220 7..209 949 83.7 Plus
Dper\GL12510-PA 235 GL12510-PA 15..220 7..211 611 53.6 Plus
Dper\GL12291-PA 365 GL12291-PA 27..234 11..211 471 41 Plus
Dper\GL14286-PA 242 GL14286-PA 1..193 17..203 424 40.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:12:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18137-PA 229 GA18137-PA 18..220 7..209 952 84.2 Plus
Dpse\GA18137-PB 212 GA18137-PB 1..203 7..209 950 84.2 Plus
Dpse\GA18133-PA 235 GA18133-PA 15..220 7..211 613 54.1 Plus
Dpse\GA26262-PB 365 GA26262-PB 27..234 11..211 474 41.5 Plus
Dpse\GA13958-PA 242 GA13958-PA 1..193 17..203 424 40.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23200-PA 233 GM23200-PA 15..233 7..216 604 51.4 Plus
Dsec\GM12394-PA 285 GM12394-PA 20..231 1..203 447 39.2 Plus
Dsec\GM23202-PA 83 GM23202-PA 12..58 1..47 256 95.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:12:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20074-PA 219 GD20074-PA 1..219 1..219 1133 95.9 Plus
Dsim\GD20073-PA 457 GD20073-PA 15..56 7..48 162 59.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:12:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23782-PA 235 GJ23782-PA 17..232 7..217 878 72.2 Plus
Dvir\GJ23780-PA 247 GJ23780-PA 17..233 9..216 651 55.5 Plus
Dvir\GJ16848-PA 256 GJ16848-PA 8..205 12..203 460 43.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12183-PA 253 GK12183-PA 23..220 11..208 843 76.3 Plus
Dwil\GK12182-PA 238 GK12182-PA 15..236 7..219 622 55.6 Plus
Dwil\GK12912-PA 379 GK12912-PA 35..242 11..211 464 41.5 Plus
Dwil\GK10292-PA 255 GK10292-PA 10..218 1..203 457 40.2 Plus
Dwil\GK22060-PA 148 GK22060-PA 83..137 158..212 165 50.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25083-PA 230 GE25083-PA 12..230 1..219 1106 93.2 Plus
Dyak\GE25081-PA 233 GE25081-PA 15..233 7..216 624 52.7 Plus
Dyak\GE16388-PA 283 GE16388-PA 19..229 1..203 444 39.3 Plus