Clone LP01932 Report

Search the DGRC for LP01932

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:19
Well:32
Vector:pOT2
Associated Gene/TranscriptCG5131-RA
Protein status:LP01932.pep: gold
Preliminary Size:1036
Sequenced Size:1030

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5131 2002-01-01 Sim4 clustering to Release 2
CG5131 2002-05-18 Blastp of sequenced clone
CG5131 2003-01-01 Sim4 clustering to Release 3
CG5131 2008-04-29 Release 5.5 accounting
CG5131 2008-08-15 Release 5.9 accounting
CG5131 2008-12-18 5.12 accounting

Clone Sequence Records

LP01932.complete Sequence

1030 bp (1030 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118981

> LP01932.complete
ATTTAACAAAAGTGGAGGATCATAGAGCCCATAAAATAATGGAGTTCCTG
ACTAAAGTGTGGGCCAAAGAGGCAACAGCGCCCGAGGCAATAGAAGCCAT
CACCGGCGCAGCGCAAGAAAAACAAAATGCAAAGACTGAAAAAGCATCTG
CCAGTAAGGAGACGAGCACCGAAGAAACCACCACTGCTCAAAAGGATTGG
GGCTACGACCTTTATCCGGAGCGAAGGGGCGAAACCTTCAAGCCCAAATG
GACACGAGTCCTGTTCGGCTTGGAGGGGCAGGAGAACATTGATCGTTTCA
AGTGCGAGGAGAATGTGTACTGGTGTGTCAAAAATGGTCCGCTGGTCAAA
CTGATGATGGGAGCACTGAAAAGTTCCGGTTGTCCCATCGATCTGCGCCG
ACACATCTCATGCGAGGTGTGCGACCCCACAGTCACCGGCGGTTACGATC
CCAAGCTCAACCAGATCGTGGTCTGCCAGAATATGGCCAGGAACAAGAGC
ATGGTCCATGGAGTGCTAACGCACGAGATGATTCACATGTTCGACTACTG
CAATAACGACATGGACTTCCGCAACGTGGACCACCTGGCCTGCACAGAGA
TCAGGGCGGCAAACCTGGCGCATTGCTCCTTCTTGAGCGCCATGTTCCAA
GGAGATGCCTCGCCATTTAATGTCAAGGAAGCGCATCAGAACTGCGTCAA
GTCCAAAGCCCTAGCTTCCGTGCTCGCTGTTCGCAATATTAGCAAAGCAG
ATGCCGTCGCTGCTGTGGAACGTGTCTTTCCCAAATGCTATGCAGACTTG
GAGCCCATTGGCCGGAGAATCCGTCGCAATTCCACGGACCAGCAGAAGGC
TTACATGGAGGCACCCATGTATGGCTATGATGTATATTAAATTGCTTTAT
ATATGCCTTTTCTTTTTTAAGTACCCACCCCCACACAATGTTAAATAAAA
CTATGTTTTAAGCTCGGGACATTTTGAATGTCACACGGCCAGACGGTTTT
ATATTTAAACCTAAAAAAAAAAAAAAAAAA

LP01932.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG5131-RA 1207 CG5131-RA 158..1171 1..1014 5070 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 17483147..17483835 1..689 3430 99.9 Plus
chr2L 23010047 chr2L 17483905..17484231 686..1012 1635 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:46:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17484540..17485228 1..689 3445 100 Plus
2L 23513712 2L 17485298..17485626 686..1014 1645 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:34:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17484540..17485228 1..689 3445 100 Plus
2L 23513712 2L 17485298..17485626 686..1014 1645 100 Plus
Blast to na_te.dros performed 2019-03-16 06:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2860..2968 68..183 132 60.3 Plus

LP01932.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:11:33 Download gff for LP01932.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 17483147..17483835 1..689 99 -> Plus
chr2L 17483909..17484231 690..1012 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:33:30 Download gff for LP01932.complete
Subject Subject Range Query Range Percent Splice Strand
CG5131-RA 1..852 39..890 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:43:49 Download gff for LP01932.complete
Subject Subject Range Query Range Percent Splice Strand
CG5131-RA 1..852 39..890 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:16:15 Download gff for LP01932.complete
Subject Subject Range Query Range Percent Splice Strand
CG5131-RA 1..852 39..890 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:35:58 Download gff for LP01932.complete
Subject Subject Range Query Range Percent Splice Strand
CG5131-RA 1..852 39..890 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:16:59 Download gff for LP01932.complete
Subject Subject Range Query Range Percent Splice Strand
CG5131-RA 1..852 39..890 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:18:31 Download gff for LP01932.complete
Subject Subject Range Query Range Percent Splice Strand
CG5131-RA 23..1034 1..1012 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:43:49 Download gff for LP01932.complete
Subject Subject Range Query Range Percent Splice Strand
CG5131-RA 23..1034 1..1012 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:16:15 Download gff for LP01932.complete
Subject Subject Range Query Range Percent Splice Strand
CG5131-RA 40..1051 1..1012 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:35:58 Download gff for LP01932.complete
Subject Subject Range Query Range Percent Splice Strand
CG5131-RA 23..1034 1..1012 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:16:59 Download gff for LP01932.complete
Subject Subject Range Query Range Percent Splice Strand
CG5131-RA 40..1051 1..1012 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:33 Download gff for LP01932.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17484540..17485228 1..689 100 -> Plus
2L 17485302..17485624 690..1012 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:33 Download gff for LP01932.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17484540..17485228 1..689 100 -> Plus
2L 17485302..17485624 690..1012 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:33 Download gff for LP01932.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17484540..17485228 1..689 100 -> Plus
2L 17485302..17485624 690..1012 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:16:15 Download gff for LP01932.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17484540..17485228 1..689 100 -> Plus
arm_2L 17485302..17485624 690..1012 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:08:23 Download gff for LP01932.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17484540..17485228 1..689 100 -> Plus
2L 17485302..17485624 690..1012 100   Plus

LP01932.hyp Sequence

Translation from 2 to 889

> LP01932.hyp
LTKVEDHRAHKIMEFLTKVWAKEATAPEAIEAITGAAQEKQNAKTEKASA
SKETSTEETTTAQKDWGYDLYPERRGETFKPKWTRVLFGLEGQENIDRFK
CEENVYWCVKNGPLVKLMMGALKSSGCPIDLRRHISCEVCDPTVTGGYDP
KLNQIVVCQNMARNKSMVHGVLTHEMIHMFDYCNNDMDFRNVDHLACTEI
RAANLAHCSFLSAMFQGDASPFNVKEAHQNCVKSKALASVLAVRNISKAD
AVAAVERVFPKCYADLEPIGRRIRRNSTDQQKAYMEAPMYGYDVY*

LP01932.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:44:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG5131-PA 283 CG5131-PA 1..283 13..295 1509 100 Plus

LP01932.pep Sequence

Translation from 38 to 889

> LP01932.pep
MEFLTKVWAKEATAPEAIEAITGAAQEKQNAKTEKASASKETSTEETTTA
QKDWGYDLYPERRGETFKPKWTRVLFGLEGQENIDRFKCEENVYWCVKNG
PLVKLMMGALKSSGCPIDLRRHISCEVCDPTVTGGYDPKLNQIVVCQNMA
RNKSMVHGVLTHEMIHMFDYCNNDMDFRNVDHLACTEIRAANLAHCSFLS
AMFQGDASPFNVKEAHQNCVKSKALASVLAVRNISKADAVAAVERVFPKC
YADLEPIGRRIRRNSTDQQKAYMEAPMYGYDVY*

LP01932.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14800-PA 285 GF14800-PA 1..285 1..283 1382 87.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21092-PA 282 GG21092-PA 1..282 1..283 1465 94.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:09:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11623-PA 275 GH11623-PA 1..275 1..283 1245 80.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG5131-PA 283 CG5131-PA 1..283 1..283 1509 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:09:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17926-PA 276 GI17926-PA 1..276 1..283 1228 80.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14503-PA 288 GL14503-PA 1..288 1..283 1308 81.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18681-PA 288 GA18681-PA 1..288 1..283 1309 81.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:09:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17243-PA 282 GM17243-PA 1..282 1..283 1479 96.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12032-PA 282 GD12032-PA 1..282 1..283 1493 97.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17699-PA 281 GJ17699-PA 1..281 1..283 1269 80.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18160-PA 279 GK18160-PA 1..279 1..283 1306 84.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12797-PA 282 GE12797-PA 1..282 1..283 1459 94 Plus