Clone LP02196 Report

Search the DGRC for LP02196

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:21
Well:96
Vector:pOT2
Associated Gene/TranscriptCdlc2-RA
Protein status:LP02196.pep: gold
Preliminary Size:811
Sequenced Size:667

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5450 2001-01-01 Release 2 assignment
CG5450 2003-01-01 Sim4 clustering to Release 3
CG5450 2003-04-28 Blastp of sequenced clone
Cdlc2 2008-04-29 Release 5.5 accounting
Cdlc2 2008-08-15 Release 5.9 accounting
Cdlc2 2008-12-18 5.12 accounting

Clone Sequence Records

LP02196.complete Sequence

667 bp (667 high quality bases) assembled on 2003-04-28

GenBank Submission: AY069718

> LP02196.complete
AGCAAGAGCCGGATAGACAGAGCCCCAAAGTGAGTCGGCAAAATCAAATA
ATACAAATACTGAATACACAGGTAGCCCCAAAGCCTTTGCGCAGATAAAC
AGCAAGAGTGATAATCGAATCGAGACAAGATGTCGGATCGCAAGGCGGTG
ATCAAGAACGCTGACATGAGCGAGGAGATGCAGCAGGACGCTGTTGACTG
CGCCACCCAGGCCCTGGAGAAGTACAACATCGAGAAGGACATCGCCGCCT
TCATCAAGAAGGAGTTCGACAAGAAGTACAACCCCACCTGGCACTGCATC
GTGGGCCGCAACTTCGGATCCTATGTGACCCACGAGACGCGCCACTTCAT
CTATTTCTACCTGGGCCAGGTGGCCATTCTGCTCTTCAAGAGCGGTTAAA
CGCATCTCGACGCCTGATAGCCGCTCTACCATGGCGCCCACCAAAGTTTT
CCGGAGGAGTCGCCAAACACTATTGTTCCTTGAATTGTAAACTCATGCAC
ACTTACGAATCCACACTCACACATACGCACTGCACTGCATTGACACACGC
ACACTTGACCTCGCGTTGATTCGTTTTTTCCCAAATTCCAAAAACTTCGC
TGTGCTGACTTAGCCACTCTGCTGCCAAATAAATCAAATACTGGTCCTGA
AAAAAAAAAAAAAAAAA

LP02196.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:52:10
Subject Length Description Subject Range Query Range Score Percent Strand
Cdlc2-RA 665 Cdlc2-RA 8..657 1..650 3250 100 Plus
Cdlc2.a 652 Cdlc2.a 70..644 76..650 2875 100 Plus
Cdlc2-RB 713 Cdlc2-RB 79..654 74..650 2845 99.8 Plus
Cdlc2.a 652 Cdlc2.a 41..69 1..29 145 100 Plus
Cdlc2-RB 713 Cdlc2-RB 59..87 1..29 145 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:10:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1344321..1344970 1..649 3185 99.7 Plus
chrX 22417052 chrX 4591072..4591236 236..400 450 84.8 Plus
chrX 22417052 chrX 4584505..4584617 126..238 310 85 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:46:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1344487..1345136 1..650 3250 100 Plus
X 23542271 X 4698295..4698459 236..400 450 84.8 Plus
X 23542271 X 4691733..4691845 126..238 310 85 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:11:41
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1344487..1345136 1..650 3250 100 Plus
X 23527363 X 4706393..4706557 236..400 450 84.8 Plus
X 23527363 X 4699831..4699943 126..238 310 84.9 Plus
Blast to na_te.dros performed on 2019-03-16 06:10:39 has no hits.

LP02196.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:11:35 Download gff for LP02196.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1344321..1344970 1..649 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:33:43 Download gff for LP02196.complete
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RB 1..270 130..399 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:48:31 Download gff for LP02196.complete
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RB 1..270 130..399 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:16:21 Download gff for LP02196.complete
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 1..270 130..399 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:30:26 Download gff for LP02196.complete
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RB 1..270 130..399 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:17:05 Download gff for LP02196.complete
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 1..270 130..399 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:58:25 Download gff for LP02196.complete
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 8..656 1..649 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:48:31 Download gff for LP02196.complete
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 8..656 1..649 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:16:21 Download gff for LP02196.complete
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 27..675 1..649 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:30:27 Download gff for LP02196.complete
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 8..656 1..649 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:17:05 Download gff for LP02196.complete
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 27..675 1..649 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:35 Download gff for LP02196.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1344487..1345135 1..649 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:35 Download gff for LP02196.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1344487..1345135 1..649 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:35 Download gff for LP02196.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1344487..1345135 1..649 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:16:21 Download gff for LP02196.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1344487..1345135 1..649 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:07:40 Download gff for LP02196.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1344487..1345135 1..649 100   Plus

LP02196.pep Sequence

Translation from 129 to 398

> LP02196.pep
MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKY
NPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG*

LP02196.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15181-PA 89 GF15181-PA 1..89 1..89 475 97.8 Plus
Dana\GF22273-PA 211 GF22273-PA 1..81 1..81 453 98.8 Plus
Dana\GF12295-PA 105 GF12295-PA 20..103 6..87 163 40.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24601-PA 89 GG24601-PA 1..89 1..89 479 100 Plus
Dere\GG24789-PA 89 GG24789-PA 1..89 1..89 479 100 Plus
Dere\GG18720-PA 89 GG18720-PA 1..89 1..89 476 98.9 Plus
Dere\GG20249-PA 104 GG20249-PA 20..102 7..87 161 41 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11410-PA 89 GH11410-PA 1..89 1..89 476 98.9 Plus
Dgri\GH24086-PA 296 GH24086-PA 1..66 1..66 333 97 Plus
Dgri\GH11409-PA 89 GH11409-PA 1..88 1..88 294 61.4 Plus
Dgri\GH19716-PA 104 GH19716-PA 19..102 6..87 155 36.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
Cdlc2-PC 89 CG5450-PC 1..89 1..89 472 100 Plus
Cdlc2-PB 89 CG5450-PB 1..89 1..89 472 100 Plus
Cdlc2-PA 89 CG5450-PA 1..89 1..89 472 100 Plus
ctp-PE 89 CG6998-PE 1..89 1..89 469 98.9 Plus
ctp-PC 89 CG6998-PC 1..89 1..89 469 98.9 Plus
ctp-PA 89 CG6998-PA 1..89 1..89 469 98.9 Plus
ctp-PB 89 CG6998-PB 1..89 1..89 469 98.9 Plus
CG8407-PB 104 CG8407-PB 20..102 7..87 168 41 Plus
CG8407-PA 104 CG8407-PA 20..102 7..87 168 41 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14563-PA 89 GI14563-PA 1..89 1..89 476 98.9 Plus
Dmoj\GI14559-PA 89 GI14559-PA 1..89 1..89 474 97.8 Plus
Dmoj\GI14909-PA 332 GI14909-PA 1..66 1..66 322 97 Plus
Dmoj\GI20135-PA 104 GI20135-PA 19..102 6..87 146 36.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15652-PA 89 GL15652-PA 1..89 1..89 453 93.3 Plus
Dper\GL13055-PA 53 GL13055-PA 1..53 37..89 287 98.1 Plus
Dper\GL11080-PA 105 GL11080-PA 21..103 7..87 164 41 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25980-PA 89 GA25980-PA 1..89 1..89 476 98.9 Plus
Dpse\GA26073-PA 89 GA26073-PA 1..89 1..89 453 93.3 Plus
Dpse\GA21054-PA 105 GA21054-PA 21..103 7..87 164 41 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16816-PA 89 GM16816-PA 1..89 1..89 479 100 Plus
Dsec\GM12359-PA 89 GM12359-PA 1..89 1..89 476 98.9 Plus
Dsec\GM21336-PA 104 GM21336-PA 20..102 7..87 161 41 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23096-PA 89 GD23096-PA 1..89 1..89 479 100 Plus
Dsim\GD15399-PA 104 GD15399-PA 20..102 7..87 161 41 Plus
Dsim\GD15397-PA 104 GD15397-PA 20..102 7..87 161 41 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17036-PA 89 GJ17036-PA 1..89 1..89 476 98.9 Plus
Dvir\GJ17025-PA 89 GJ17025-PA 1..89 1..89 473 96.6 Plus
Dvir\GJ18941-PA 310 GJ18941-PA 1..66 1..66 321 97 Plus
Dvir\GJ19905-PA 104 GJ19905-PA 19..102 6..87 168 39.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25335-PA 268 GK25335-PA 1..88 1..88 498 98.9 Plus
Dwil\GK15188-PA 89 GK15188-PA 1..89 1..89 476 98.9 Plus
Dwil\GK23006-PA 105 GK23006-PA 21..103 7..87 164 41 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17560-PA 89 GE17560-PA 1..89 1..89 479 100 Plus
Dyak\ctp-PA 89 GE16358-PA 1..89 1..89 476 98.9 Plus
Dyak\GE12408-PA 104 GE12408-PA 20..102 7..87 161 41 Plus

LP02196.hyp Sequence

Translation from 129 to 398

> LP02196.hyp
MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKY
NPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG*

LP02196.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:09:21
Subject Length Description Subject Range Query Range Score Percent Strand
Cdlc2-PC 89 CG5450-PC 1..89 1..89 472 100 Plus
Cdlc2-PB 89 CG5450-PB 1..89 1..89 472 100 Plus
Cdlc2-PA 89 CG5450-PA 1..89 1..89 472 100 Plus
ctp-PE 89 CG6998-PE 1..89 1..89 469 98.9 Plus
ctp-PC 89 CG6998-PC 1..89 1..89 469 98.9 Plus