LP02306.complete Sequence
628 bp (628 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118986
> LP02306.complete
ACATGTTCAATATTAAATTGCTGCTTTTGTTATTGGCCGTTTCGTGGTTC
CACCATGGACAAGCCGTCCAGGAGACGAAAATCGAAGAAAAACCAGTATC
AGAGCCTGAAATTGAATCCGAAATAAAGAACTCTACGAGCGTCCCAAGTA
AATGCAATATTTACTATAGGAACTACCAATGGGCTCTTCAGGATTGTGTC
TGCCGTTGTTTCCAAAACGAATGCCTTATGCAAATCGAGAGCGACCAGCG
CAAAAAGGAGGGTAGATCCCCATTTGTGCCCGTTACGGAGGAACTCTGCC
GTTCCTTCATCTGCAAAAAGTGCAGCGTGGGTTTCCCCGTGGTTGCTGAA
TTCCCCATTCCGGCTCCCTGTGGATGCAATCGAAAGCCAGGATCGATTGC
CACAGAGAGATTCTACAGTTTGTGCCACCTGCTGAAATTCTCAGCGGAGA
ACAGCAAACCATTCCTGACTTATTCCTATTGTTGGCCCTTCTAAGTGAGG
TGGATTCAGTTGGATCACGTTACTAATATCTTTGTTTGTTTGTTTTATTA
TTTTGTTGATTTGTTCATTTAAAGGGAGATGGATTACAAATAATAAAGAA
ATATATTCAAAAAAAAAAAAAAAAAAAA
LP02306.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:54:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sgs5-RA | 691 | Sgs5-RA | 50..659 | 1..610 | 3050 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:31:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 13419726..13419995 | 1..270 | 1350 | 100 | Plus |
chr3R | 27901430 | chr3R | 13420052..13420238 | 271..457 | 920 | 99.5 | Plus |
chr3R | 27901430 | chr3R | 13420300..13420448 | 460..608 | 745 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:46:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:31:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 17595390..17595659 | 1..270 | 1350 | 100 | Plus |
3R | 32079331 | 3R | 17595716..17595904 | 271..459 | 945 | 100 | Plus |
3R | 32079331 | 3R | 17595964..17596114 | 460..610 | 755 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 17336221..17336490 | 1..270 | 1350 | 100 | Plus |
3R | 31820162 | 3R | 17336547..17336735 | 271..459 | 945 | 100 | Plus |
3R | 31820162 | 3R | 17336795..17336945 | 460..610 | 755 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 11:31:32 has no hits.
LP02306.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:32:10 Download gff for
LP02306.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 13420052..13420240 | 271..459 | 98 | -> | Plus |
chr3R | 13420300..13420448 | 460..608 | 100 | | Plus |
chr3R | 13419726..13419995 | 1..270 | 100 | -> | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:33:47 Download gff for
LP02306.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs5-RA | 1..492 | 3..494 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:26 Download gff for
LP02306.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs5-RA | 1..492 | 3..494 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:58:32 Download gff for
LP02306.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs5-RA | 1..492 | 3..494 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:34:48 Download gff for
LP02306.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs5-RA | 1..492 | 3..494 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:20:24 Download gff for
LP02306.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs5-RA | 1..492 | 3..494 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:04:15 Download gff for
LP02306.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs5-RA | 1..540 | 1..540 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:26 Download gff for
LP02306.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs5-RA | 29..636 | 1..608 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:58:32 Download gff for
LP02306.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs5-RA | 29..636 | 1..608 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:34:48 Download gff for
LP02306.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs5-RA | 1..540 | 1..540 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:20:24 Download gff for
LP02306.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs5-RA | 29..636 | 1..608 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:32:10 Download gff for
LP02306.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17595390..17595659 | 1..270 | 100 | -> | Plus |
3R | 17595716..17595904 | 271..459 | 100 | -> | Plus |
3R | 17595964..17596112 | 460..608 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:32:10 Download gff for
LP02306.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17595390..17595659 | 1..270 | 100 | -> | Plus |
3R | 17595716..17595904 | 271..459 | 100 | -> | Plus |
3R | 17595964..17596112 | 460..608 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:32:10 Download gff for
LP02306.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17595390..17595659 | 1..270 | 100 | -> | Plus |
3R | 17595716..17595904 | 271..459 | 100 | -> | Plus |
3R | 17595964..17596112 | 460..608 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:58:32 Download gff for
LP02306.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 13421112..13421381 | 1..270 | 100 | -> | Plus |
arm_3R | 13421438..13421626 | 271..459 | 100 | -> | Plus |
arm_3R | 13421686..13421834 | 460..608 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:16:48 Download gff for
LP02306.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17336221..17336490 | 1..270 | 100 | -> | Plus |
3R | 17336547..17336735 | 271..459 | 100 | -> | Plus |
3R | 17336795..17336943 | 460..608 | 100 | | Plus |
LP02306.pep Sequence
Translation from 2 to 493
> LP02306.pep
MFNIKLLLLLLAVSWFHHGQAVQETKIEEKPVSEPEIESEIKNSTSVPSK
CNIYYRNYQWALQDCVCRCFQNECLMQIESDQRKKEGRSPFVPVTEELCR
SFICKKCSVGFPVVAEFPIPAPCGCNRKPGSIATERFYSLCHLLKFSAEN
SKPFLTYSYCWPF*
LP02306.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:30:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF16411-PA | 172 | GF16411-PA | 1..167 | 1..163 | 447 | 53.3 | Plus |
Dana\GF19880-PA | 166 | GF19880-PA | 41..137 | 56..151 | 236 | 45.4 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:30:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22329-PA | 142 | GG22329-PA | 31..142 | 49..160 | 362 | 55.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sgs5-PA | 163 | CG7596-PA | 1..163 | 1..163 | 897 | 100 | Plus |
CG7587-PA | 142 | CG7587-PA | 1..142 | 1..160 | 395 | 46.2 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:30:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI24797-PA | 145 | GI24797-PA | 31..143 | 48..160 | 270 | 47.8 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:30:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL13780-PA | 144 | GL13780-PA | 31..140 | 49..158 | 372 | 58.2 | Plus |
Dper\GL23939-PA | 148 | GL23939-PA | 25..139 | 38..155 | 151 | 32 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:30:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA20459-PA | 144 | GA20459-PA | 31..140 | 49..158 | 363 | 55.5 | Plus |
Dpse\GA27116-PA | 148 | GA27116-PA | 25..139 | 38..155 | 151 | 32 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:30:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM15245-PA | 169 | GM15245-PA | 1..169 | 1..163 | 687 | 85.2 | Plus |
Dsec\GM15244-PA | 142 | GM15244-PA | 1..142 | 1..160 | 382 | 47.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:30:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD19170-PA | 169 | GD19170-PA | 1..169 | 1..163 | 701 | 86.4 | Plus |
Dsim\GD19169-PA | 142 | GD19169-PA | 1..142 | 1..160 | 384 | 47.5 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:30:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ24445-PA | 143 | GJ24445-PA | 25..139 | 46..160 | 281 | 49.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:30:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE25481-PA | 192 | GE25481-PA | 1..192 | 1..163 | 614 | 66.7 | Plus |
Dyak\GE25480-PA | 142 | GE25480-PA | 24..142 | 42..160 | 345 | 49.6 | Plus |
LP02306.hyp Sequence
Translation from 2 to 493
> LP02306.hyp
MFNIKLLLLLLAVSWFHHGQAVQETKIEEKPVSEPEIESEIKNSTSVPSK
CNIYYRNYQWALQDCVCRCFQNECLMQIESDQRKKEGRSPFVPVTEELCR
SFICKKCSVGFPVVAEFPIPAPCGCNRKPGSIATERFYSLCHLLKFSAEN
SKPFLTYSYCWPF*
LP02306.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:49:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sgs5-PA | 163 | CG7596-PA | 1..163 | 1..163 | 897 | 100 | Plus |
CG7587-PA | 142 | CG7587-PA | 1..142 | 1..160 | 395 | 46.2 | Plus |