Clone LP02306 Report

Search the DGRC for LP02306

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:23
Well:6
Vector:pOT2
Associated Gene/TranscriptSgs5-RA
Protein status:LP02306.pep: gold
Preliminary Size:540
Sequenced Size:628

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7596 2002-01-01 Sim4 clustering to Release 2
CG7596 2002-05-18 Blastp of sequenced clone
CG7596 2003-01-01 Sim4 clustering to Release 3
Sgs5 2008-04-29 Release 5.5 accounting
Sgs5 2008-08-15 Release 5.9 accounting
Sgs5 2008-12-18 5.12 accounting

Clone Sequence Records

LP02306.complete Sequence

628 bp (628 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118986

> LP02306.complete
ACATGTTCAATATTAAATTGCTGCTTTTGTTATTGGCCGTTTCGTGGTTC
CACCATGGACAAGCCGTCCAGGAGACGAAAATCGAAGAAAAACCAGTATC
AGAGCCTGAAATTGAATCCGAAATAAAGAACTCTACGAGCGTCCCAAGTA
AATGCAATATTTACTATAGGAACTACCAATGGGCTCTTCAGGATTGTGTC
TGCCGTTGTTTCCAAAACGAATGCCTTATGCAAATCGAGAGCGACCAGCG
CAAAAAGGAGGGTAGATCCCCATTTGTGCCCGTTACGGAGGAACTCTGCC
GTTCCTTCATCTGCAAAAAGTGCAGCGTGGGTTTCCCCGTGGTTGCTGAA
TTCCCCATTCCGGCTCCCTGTGGATGCAATCGAAAGCCAGGATCGATTGC
CACAGAGAGATTCTACAGTTTGTGCCACCTGCTGAAATTCTCAGCGGAGA
ACAGCAAACCATTCCTGACTTATTCCTATTGTTGGCCCTTCTAAGTGAGG
TGGATTCAGTTGGATCACGTTACTAATATCTTTGTTTGTTTGTTTTATTA
TTTTGTTGATTTGTTCATTTAAAGGGAGATGGATTACAAATAATAAAGAA
ATATATTCAAAAAAAAAAAAAAAAAAAA

LP02306.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
Sgs5-RA 691 Sgs5-RA 50..659 1..610 3050 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:31:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13419726..13419995 1..270 1350 100 Plus
chr3R 27901430 chr3R 13420052..13420238 271..457 920 99.5 Plus
chr3R 27901430 chr3R 13420300..13420448 460..608 745 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:46:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:31:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17595390..17595659 1..270 1350 100 Plus
3R 32079331 3R 17595716..17595904 271..459 945 100 Plus
3R 32079331 3R 17595964..17596114 460..610 755 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17336221..17336490 1..270 1350 100 Plus
3R 31820162 3R 17336547..17336735 271..459 945 100 Plus
3R 31820162 3R 17336795..17336945 460..610 755 100 Plus
Blast to na_te.dros performed on 2019-03-16 11:31:32 has no hits.

LP02306.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:32:10 Download gff for LP02306.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13420052..13420240 271..459 98 -> Plus
chr3R 13420300..13420448 460..608 100   Plus
chr3R 13419726..13419995 1..270 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:33:47 Download gff for LP02306.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs5-RA 1..492 3..494 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:26 Download gff for LP02306.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs5-RA 1..492 3..494 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:58:32 Download gff for LP02306.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs5-RA 1..492 3..494 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:34:48 Download gff for LP02306.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs5-RA 1..492 3..494 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:20:24 Download gff for LP02306.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs5-RA 1..492 3..494 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:04:15 Download gff for LP02306.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs5-RA 1..540 1..540 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:26 Download gff for LP02306.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs5-RA 29..636 1..608 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:58:32 Download gff for LP02306.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs5-RA 29..636 1..608 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:34:48 Download gff for LP02306.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs5-RA 1..540 1..540 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:20:24 Download gff for LP02306.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs5-RA 29..636 1..608 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:32:10 Download gff for LP02306.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17595390..17595659 1..270 100 -> Plus
3R 17595716..17595904 271..459 100 -> Plus
3R 17595964..17596112 460..608 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:32:10 Download gff for LP02306.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17595390..17595659 1..270 100 -> Plus
3R 17595716..17595904 271..459 100 -> Plus
3R 17595964..17596112 460..608 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:32:10 Download gff for LP02306.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17595390..17595659 1..270 100 -> Plus
3R 17595716..17595904 271..459 100 -> Plus
3R 17595964..17596112 460..608 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:58:32 Download gff for LP02306.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13421112..13421381 1..270 100 -> Plus
arm_3R 13421438..13421626 271..459 100 -> Plus
arm_3R 13421686..13421834 460..608 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:16:48 Download gff for LP02306.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17336221..17336490 1..270 100 -> Plus
3R 17336547..17336735 271..459 100 -> Plus
3R 17336795..17336943 460..608 100   Plus

LP02306.pep Sequence

Translation from 2 to 493

> LP02306.pep
MFNIKLLLLLLAVSWFHHGQAVQETKIEEKPVSEPEIESEIKNSTSVPSK
CNIYYRNYQWALQDCVCRCFQNECLMQIESDQRKKEGRSPFVPVTEELCR
SFICKKCSVGFPVVAEFPIPAPCGCNRKPGSIATERFYSLCHLLKFSAEN
SKPFLTYSYCWPF*

LP02306.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16411-PA 172 GF16411-PA 1..167 1..163 447 53.3 Plus
Dana\GF19880-PA 166 GF19880-PA 41..137 56..151 236 45.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22329-PA 142 GG22329-PA 31..142 49..160 362 55.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
Sgs5-PA 163 CG7596-PA 1..163 1..163 897 100 Plus
CG7587-PA 142 CG7587-PA 1..142 1..160 395 46.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24797-PA 145 GI24797-PA 31..143 48..160 270 47.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13780-PA 144 GL13780-PA 31..140 49..158 372 58.2 Plus
Dper\GL23939-PA 148 GL23939-PA 25..139 38..155 151 32 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20459-PA 144 GA20459-PA 31..140 49..158 363 55.5 Plus
Dpse\GA27116-PA 148 GA27116-PA 25..139 38..155 151 32 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15245-PA 169 GM15245-PA 1..169 1..163 687 85.2 Plus
Dsec\GM15244-PA 142 GM15244-PA 1..142 1..160 382 47.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19170-PA 169 GD19170-PA 1..169 1..163 701 86.4 Plus
Dsim\GD19169-PA 142 GD19169-PA 1..142 1..160 384 47.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24445-PA 143 GJ24445-PA 25..139 46..160 281 49.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25481-PA 192 GE25481-PA 1..192 1..163 614 66.7 Plus
Dyak\GE25480-PA 142 GE25480-PA 24..142 42..160 345 49.6 Plus

LP02306.hyp Sequence

Translation from 2 to 493

> LP02306.hyp
MFNIKLLLLLLAVSWFHHGQAVQETKIEEKPVSEPEIESEIKNSTSVPSK
CNIYYRNYQWALQDCVCRCFQNECLMQIESDQRKKEGRSPFVPVTEELCR
SFICKKCSVGFPVVAEFPIPAPCGCNRKPGSIATERFYSLCHLLKFSAEN
SKPFLTYSYCWPF*

LP02306.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:49:28
Subject Length Description Subject Range Query Range Score Percent Strand
Sgs5-PA 163 CG7596-PA 1..163 1..163 897 100 Plus
CG7587-PA 142 CG7587-PA 1..142 1..160 395 46.2 Plus