BDGP Sequence Production Resources |
Search the DGRC for LP02570
Library: | LP |
Tissue Source: | Drosophila melanogaster larval-early pupal |
Created by: | Ling Hong |
Date Registered: | 1998-06-11 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 25 |
Well: | 70 |
Vector: | pOT2 |
Associated Gene/Transcript | hui-RA |
Protein status: | LP02570.pep: gold |
Preliminary Size: | 955 |
Sequenced Size: | 840 |
Gene | Date | Evidence |
---|---|---|
CG10200 | 2001-01-01 | Release 2 assignment |
CG10200 | 2002-05-17 | Blastp of sequenced clone |
CG10200 | 2003-01-01 | Sim4 clustering to Release 3 |
CG10200 | 2008-04-29 | Release 5.5 accounting |
CG10200 | 2008-08-15 | Release 5.9 accounting |
CG10200 | 2008-12-18 | 5.12 accounting |
840 bp (840 high quality bases) assembled on 2002-05-17
GenBank Submission: AY118599
> LP02570.complete TTCGCTGCCTCAGTCTTTCGTTTCGTCTTTGTGAGTGCTTAACCGCAGAT AGGCCCCTCTGCATACCCCTAACCGCTGAATTAACCCTACTAAGTGACGA AGTGTGTGTTCTTACAGATCCATACCGCTTCACAATGAAGTACGCTGTGA TTGCCATCGCTTTGTTTGCGATTACTACCGCTTCGGCCTCTTCCGCTGGC CAGTTTCTGCCCCGTGCCTTCTTCACCTTGGACTCGGAGGGCCACCAGTC GAATGTCCATCCCGTGAATGCCCATCTCCTGAGGCGTCTGCGTCGTCAGT CCAGTTCGTCTTCCTCGTCATCATCCTCCTCGTCCTCCAGTGGAGGAAAC GTCTTCACCTACGCCTCACACAGCGTTCAGAATGCCGATGGCTCCGGTCA TTCTGGCTCCTCTTACACCCAGCAGGCCGCTGCTCCAGTGCTTGGTGGTG TGTCCTTTGATGAGCGTTTCGGCGAGAGCTCCTTAACTGGAGGCGACAAC TATTATCCCACCTACAATGGCTACACCAGCGCAGCCTCCATCAGCAGCAA CAGCGGAGTAGGAAGCACCGGTAGCTATCAGCACATCTCCGGAGTTGGAC CCATTCCCGCCACCCAAATCCAGCAGACCGTGGCCGTTGTCGATGCCAGT GGCAACCAGAAGGTGACCAACATCCAGGGTGCCACCGATTCCAACGGCGT TCTCAATATCAAGAAGACCGAATCCACTTACTCATCCAAATAGAACATAG GTTTTTTTTCGAGTGTAAACTTTAATAAATTACAGTAAATTAAAAAAAAA AAAAAAAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG10200-RA | 900 | CG10200-RA | 63..855 | 1..793 | 3965 | 100 | Plus |
CG10200.a | 758 | CG10200.a | 70..758 | 103..791 | 3445 | 100 | Plus |
CG10200-RB | 813 | CG10200-RB | 93..768 | 118..793 | 3380 | 100 | Plus |
CG10200.a | 758 | CG10200.a | 40..69 | 1..30 | 150 | 100 | Plus |
CG10200-RB | 813 | CG10200-RB | 63..92 | 1..30 | 150 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 10696895..10697243 | 445..793 | 1745 | 100 | Plus |
chr2R | 21145070 | chr2R | 10696583..10696833 | 195..445 | 1255 | 100 | Plus |
chr2R | 21145070 | chr2R | 10695759..10695953 | 1..195 | 930 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 14809585..14809933 | 445..793 | 1745 | 100 | Plus |
2R | 25286936 | 2R | 14809273..14809523 | 195..445 | 1255 | 100 | Plus |
2R | 25286936 | 2R | 14808449..14808643 | 1..195 | 975 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 14810784..14811132 | 445..793 | 1745 | 100 | Plus |
2R | 25260384 | 2R | 14810472..14810722 | 195..445 | 1255 | 100 | Plus |
2R | 25260384 | 2R | 14809648..14809842 | 1..195 | 975 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
TART-B | 10654 | TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). | 121..169 | 508..556 | 119 | 71.4 | Plus |
TART-B | 10654 | TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). | 9151..9199 | 508..556 | 119 | 71.4 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6763..6824 | 493..554 | 111 | 68.3 | Plus |
Dbuz\Osvaldo | 9045 | Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). | 2169..2269 | 346..239 | 108 | 61.1 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 10695759..10695953 | 1..195 | 98 | -> | Plus |
chr2R | 10696584..10696833 | 196..445 | 100 | -> | Plus |
chr2R | 10696896..10697241 | 446..791 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10200-RA | 1..609 | 135..743 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10200-RA | 1..609 | 135..743 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10200-RB | 1..609 | 135..743 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10200-RA | 1..609 | 135..743 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
hui-RB | 1..609 | 135..743 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10200-RA | 1..791 | 1..791 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10200-RA | 1..791 | 1..791 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10200-RA | 31..821 | 1..791 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10200-RA | 1..791 | 1..791 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
hui-RA | 31..821 | 1..791 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14809274..14809523 | 196..445 | 100 | -> | Plus |
2R | 14809586..14809931 | 446..791 | 100 | Plus | |
2R | 14808449..14808643 | 1..195 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14809274..14809523 | 196..445 | 100 | -> | Plus |
2R | 14809586..14809931 | 446..791 | 100 | Plus | |
2R | 14808449..14808643 | 1..195 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14809274..14809523 | 196..445 | 100 | -> | Plus |
2R | 14809586..14809931 | 446..791 | 100 | Plus | |
2R | 14808449..14808643 | 1..195 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 10695954..10696148 | 1..195 | 100 | -> | Plus |
arm_2R | 10696779..10697028 | 196..445 | 100 | -> | Plus |
arm_2R | 10697091..10697436 | 446..791 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14809648..14809842 | 1..195 | 100 | -> | Plus |
2R | 14810785..14811130 | 446..791 | 100 | Plus | |
2R | 14810473..14810722 | 196..445 | 100 | -> | Plus |
Translation from 2 to 742
> LP02570.hyp RCLSLSFRLCECLTADRPLCIPLTAELTLLSDEVCVLTDPYRFTMKYAVI AIALFAITTASASSAGQFLPRAFFTLDSEGHQSNVHPVNAHLLRRLRRQS SSSSSSSSSSSSSGGNVFTYASHSVQNADGSGHSGSSYTQQAAAPVLGGV SFDERFGESSLTGGDNYYPTYNGYTSAASISSNSGVGSTGSYQHISGVGP IPATQIQQTVAVVDASGNQKVTNIQGATDSNGVLNIKKTESTYSSK*
Translation from 134 to 742
> LP02570.pep MKYAVIAIALFAITTASASSAGQFLPRAFFTLDSEGHQSNVHPVNAHLLR RLRRQSSSSSSSSSSSSSSGGNVFTYASHSVQNADGSGHSGSSYTQQAAA PVLGGVSFDERFGESSLTGGDNYYPTYNGYTSAASISSNSGVGSTGSYQH ISGVGPIPATQIQQTVAVVDASGNQKVTNIQGATDSNGVLNIKKTESTYS SK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13136-PA | 218 | GF13136-PA | 1..217 | 1..201 | 564 | 68.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20482-PA | 188 | GG20482-PA | 1..188 | 1..202 | 473 | 70.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19667-PA | 188 | GH19667-PA | 1..121 | 1..119 | 297 | 61.1 | Plus |
Dgri\GH21417-PA | 186 | GH21417-PA | 1..119 | 1..119 | 296 | 62.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
hui-PA | 202 | CG10200-PA | 1..202 | 1..202 | 1010 | 100 | Plus |
hui-PB | 202 | CG10200-PB | 1..202 | 1..202 | 1010 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18592-PA | 201 | GI18592-PA | 1..116 | 1..119 | 276 | 61.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11438-PA | 188 | GL11438-PA | 1..185 | 1..199 | 424 | 61.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10150-PA | 188 | GA10150-PA | 1..185 | 1..199 | 428 | 61.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21573-PA | 196 | GM21573-PA | 1..195 | 1..197 | 627 | 76 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11078-PA | 208 | GD11078-PA | 1..173 | 1..177 | 500 | 71.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20390-PA | 184 | GJ20390-PA | 20..181 | 19..199 | 250 | 45.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22914-PA | 206 | GK22914-PA | 21..206 | 22..199 | 320 | 50.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13612-PA | 210 | GE13612-PA | 1..209 | 1..197 | 496 | 63 | Plus |