Clone LP02570 Report

Search the DGRC for LP02570

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:25
Well:70
Vector:pOT2
Associated Gene/Transcripthui-RA
Protein status:LP02570.pep: gold
Preliminary Size:955
Sequenced Size:840

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10200 2001-01-01 Release 2 assignment
CG10200 2002-05-17 Blastp of sequenced clone
CG10200 2003-01-01 Sim4 clustering to Release 3
CG10200 2008-04-29 Release 5.5 accounting
CG10200 2008-08-15 Release 5.9 accounting
CG10200 2008-12-18 5.12 accounting

Clone Sequence Records

LP02570.complete Sequence

840 bp (840 high quality bases) assembled on 2002-05-17

GenBank Submission: AY118599

> LP02570.complete
TTCGCTGCCTCAGTCTTTCGTTTCGTCTTTGTGAGTGCTTAACCGCAGAT
AGGCCCCTCTGCATACCCCTAACCGCTGAATTAACCCTACTAAGTGACGA
AGTGTGTGTTCTTACAGATCCATACCGCTTCACAATGAAGTACGCTGTGA
TTGCCATCGCTTTGTTTGCGATTACTACCGCTTCGGCCTCTTCCGCTGGC
CAGTTTCTGCCCCGTGCCTTCTTCACCTTGGACTCGGAGGGCCACCAGTC
GAATGTCCATCCCGTGAATGCCCATCTCCTGAGGCGTCTGCGTCGTCAGT
CCAGTTCGTCTTCCTCGTCATCATCCTCCTCGTCCTCCAGTGGAGGAAAC
GTCTTCACCTACGCCTCACACAGCGTTCAGAATGCCGATGGCTCCGGTCA
TTCTGGCTCCTCTTACACCCAGCAGGCCGCTGCTCCAGTGCTTGGTGGTG
TGTCCTTTGATGAGCGTTTCGGCGAGAGCTCCTTAACTGGAGGCGACAAC
TATTATCCCACCTACAATGGCTACACCAGCGCAGCCTCCATCAGCAGCAA
CAGCGGAGTAGGAAGCACCGGTAGCTATCAGCACATCTCCGGAGTTGGAC
CCATTCCCGCCACCCAAATCCAGCAGACCGTGGCCGTTGTCGATGCCAGT
GGCAACCAGAAGGTGACCAACATCCAGGGTGCCACCGATTCCAACGGCGT
TCTCAATATCAAGAAGACCGAATCCACTTACTCATCCAAATAGAACATAG
GTTTTTTTTCGAGTGTAAACTTTAATAAATTACAGTAAATTAAAAAAAAA
AAAAAAAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LP02570.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:20:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG10200-RA 900 CG10200-RA 63..855 1..793 3965 100 Plus
CG10200.a 758 CG10200.a 70..758 103..791 3445 100 Plus
CG10200-RB 813 CG10200-RB 93..768 118..793 3380 100 Plus
CG10200.a 758 CG10200.a 40..69 1..30 150 100 Plus
CG10200-RB 813 CG10200-RB 63..92 1..30 150 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10696895..10697243 445..793 1745 100 Plus
chr2R 21145070 chr2R 10696583..10696833 195..445 1255 100 Plus
chr2R 21145070 chr2R 10695759..10695953 1..195 930 98.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:47:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14809585..14809933 445..793 1745 100 Plus
2R 25286936 2R 14809273..14809523 195..445 1255 100 Plus
2R 25286936 2R 14808449..14808643 1..195 975 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:43:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14810784..14811132 445..793 1745 100 Plus
2R 25260384 2R 14810472..14810722 195..445 1255 100 Plus
2R 25260384 2R 14809648..14809842 1..195 975 100 Plus
Blast to na_te.dros performed 2019-03-16 20:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 121..169 508..556 119 71.4 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 9151..9199 508..556 119 71.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6763..6824 493..554 111 68.3 Plus
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 2169..2269 346..239 108 61.1 Minus

LP02570.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:47:20 Download gff for LP02570.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10695759..10695953 1..195 98 -> Plus
chr2R 10696584..10696833 196..445 100 -> Plus
chr2R 10696896..10697241 446..791 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:33:54 Download gff for LP02570.complete
Subject Subject Range Query Range Percent Splice Strand
CG10200-RA 1..609 135..743 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:03:43 Download gff for LP02570.complete
Subject Subject Range Query Range Percent Splice Strand
CG10200-RA 1..609 135..743 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:27:56 Download gff for LP02570.complete
Subject Subject Range Query Range Percent Splice Strand
CG10200-RB 1..609 135..743 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:34:19 Download gff for LP02570.complete
Subject Subject Range Query Range Percent Splice Strand
CG10200-RA 1..609 135..743 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:53:07 Download gff for LP02570.complete
Subject Subject Range Query Range Percent Splice Strand
hui-RB 1..609 135..743 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:52:27 Download gff for LP02570.complete
Subject Subject Range Query Range Percent Splice Strand
CG10200-RA 1..791 1..791 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:03:42 Download gff for LP02570.complete
Subject Subject Range Query Range Percent Splice Strand
CG10200-RA 1..791 1..791 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:27:56 Download gff for LP02570.complete
Subject Subject Range Query Range Percent Splice Strand
CG10200-RA 31..821 1..791 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:34:19 Download gff for LP02570.complete
Subject Subject Range Query Range Percent Splice Strand
CG10200-RA 1..791 1..791 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:53:07 Download gff for LP02570.complete
Subject Subject Range Query Range Percent Splice Strand
hui-RA 31..821 1..791 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:47:20 Download gff for LP02570.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14809274..14809523 196..445 100 -> Plus
2R 14809586..14809931 446..791 100   Plus
2R 14808449..14808643 1..195 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:47:20 Download gff for LP02570.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14809274..14809523 196..445 100 -> Plus
2R 14809586..14809931 446..791 100   Plus
2R 14808449..14808643 1..195 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:47:20 Download gff for LP02570.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14809274..14809523 196..445 100 -> Plus
2R 14809586..14809931 446..791 100   Plus
2R 14808449..14808643 1..195 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:27:56 Download gff for LP02570.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10695954..10696148 1..195 100 -> Plus
arm_2R 10696779..10697028 196..445 100 -> Plus
arm_2R 10697091..10697436 446..791 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:11:11 Download gff for LP02570.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14809648..14809842 1..195 100 -> Plus
2R 14810785..14811130 446..791 100   Plus
2R 14810473..14810722 196..445 100 -> Plus

LP02570.hyp Sequence

Translation from 2 to 742

> LP02570.hyp
RCLSLSFRLCECLTADRPLCIPLTAELTLLSDEVCVLTDPYRFTMKYAVI
AIALFAITTASASSAGQFLPRAFFTLDSEGHQSNVHPVNAHLLRRLRRQS
SSSSSSSSSSSSSGGNVFTYASHSVQNADGSGHSGSSYTQQAAAPVLGGV
SFDERFGESSLTGGDNYYPTYNGYTSAASISSNSGVGSTGSYQHISGVGP
IPATQIQQTVAVVDASGNQKVTNIQGATDSNGVLNIKKTESTYSSK*

LP02570.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
hui-PA 202 CG10200-PA 1..202 45..246 1010 100 Plus
hui-PB 202 CG10200-PB 1..202 45..246 1010 100 Plus

LP02570.pep Sequence

Translation from 134 to 742

> LP02570.pep
MKYAVIAIALFAITTASASSAGQFLPRAFFTLDSEGHQSNVHPVNAHLLR
RLRRQSSSSSSSSSSSSSSGGNVFTYASHSVQNADGSGHSGSSYTQQAAA
PVLGGVSFDERFGESSLTGGDNYYPTYNGYTSAASISSNSGVGSTGSYQH
ISGVGPIPATQIQQTVAVVDASGNQKVTNIQGATDSNGVLNIKKTESTYS
SK*

LP02570.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:45:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13136-PA 218 GF13136-PA 1..217 1..201 564 68.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20482-PA 188 GG20482-PA 1..188 1..202 473 70.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:45:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19667-PA 188 GH19667-PA 1..121 1..119 297 61.1 Plus
Dgri\GH21417-PA 186 GH21417-PA 1..119 1..119 296 62.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:04
Subject Length Description Subject Range Query Range Score Percent Strand
hui-PA 202 CG10200-PA 1..202 1..202 1010 100 Plus
hui-PB 202 CG10200-PB 1..202 1..202 1010 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:45:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18592-PA 201 GI18592-PA 1..116 1..119 276 61.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11438-PA 188 GL11438-PA 1..185 1..199 424 61.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10150-PA 188 GA10150-PA 1..185 1..199 428 61.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21573-PA 196 GM21573-PA 1..195 1..197 627 76 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:45:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11078-PA 208 GD11078-PA 1..173 1..177 500 71.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:45:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20390-PA 184 GJ20390-PA 20..181 19..199 250 45.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:45:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22914-PA 206 GK22914-PA 21..206 22..199 320 50.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:45:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13612-PA 210 GE13612-PA 1..209 1..197 496 63 Plus