Clone LP02725 Report

Search the DGRC for LP02725

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:27
Well:25
Vector:pOT2
Associated Gene/TranscriptCG31698-RA
Protein status:LP02725.pep: gold
Sequenced Size:496

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3485 2002-01-01 Sim4 clustering to Release 2
CG31698 2002-05-18 Blastp of sequenced clone
CG31698 2003-01-01 Sim4 clustering to Release 3
CG31698 2008-04-29 Release 5.5 accounting
CG31698 2008-08-15 Release 5.9 accounting
CG31698 2008-12-18 5.12 accounting

Clone Sequence Records

LP02725.complete Sequence

496 bp (496 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118992

> LP02725.complete
CATGAGAGCAATACGAGTTCTGCTGATTTTCCAACTGCTGGCTTGTCTAA
TGGCCGTAATATCGGGCTGCAACCAGGGGTCCTGCCATCCGTTCATTGGC
CTGAACAAGTGCAATGGTAATGGCTATAAGGAGCCCAAACTTCCACCTCG
GGATAACGCCTGCTGCGGTGCCCATTGCGTCTACAATGGTCCAAGTTGTC
AAAATCCCGGTCCCTGCGACAGCAAACCCGTGAATCGTTGCATCCTGGAC
TCACATTGTGGCAAAGGCGTAGCCTTCTACTTCGTATGCAAGTCAGATTG
TGAACTGATAAAGGAAAATGAAGCTCGCCAGGCAGCTGGATATGCCCGTC
TTCTTTCATTTTCGTGGGGCAAGCAGAAATGCGAGGGCATGAATTACAAA
TGCGGCATCAATTGTTGCTGTCGTGAGTATTGTCCTAAACGGTTTTGTAA
ATTTTAATGCGGTCAATAAAGGGTATTAAAAAAAAAAAAAAAAAAA

LP02725.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG31698-RA 551 CG31698-RA 27..511 1..485 2425 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:17:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3173105..3173453 349..1 1730 99.7 Minus
chr2L 23010047 chr2L 3172910..3173039 477..348 650 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:47:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:17:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3173478..3173826 349..1 1745 100 Minus
2L 23513712 2L 3173275..3173412 485..348 690 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3173478..3173826 349..1 1745 100 Minus
2L 23513712 2L 3173275..3173412 485..348 690 100 Minus
Blast to na_te.dros performed on 2019-03-16 20:17:47 has no hits.

LP02725.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:18:42 Download gff for LP02725.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3172910..3173039 348..477 100 <- Minus
chr2L 3173107..3173453 1..347 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:12:32 Download gff for LP02725.complete
Subject Subject Range Query Range Percent Splice Strand
CG31698-RA 1..456 2..457 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:54 Download gff for LP02725.complete
Subject Subject Range Query Range Percent Splice Strand
CG31698-RA 1..456 2..457 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:57:06 Download gff for LP02725.complete
Subject Subject Range Query Range Percent Splice Strand
CG31698-RA 1..456 2..457 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:57:22 Download gff for LP02725.complete
Subject Subject Range Query Range Percent Splice Strand
CG31698-RA 1..456 2..457 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:07:25 Download gff for LP02725.complete
Subject Subject Range Query Range Percent Splice Strand
CG31698-RA 1..477 1..477 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:12:32 Download gff for LP02725.complete
Subject Subject Range Query Range Percent Splice Strand
CG31698-RA 1..477 1..477 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:54 Download gff for LP02725.complete
Subject Subject Range Query Range Percent Splice Strand
CG31698-RA 1..477 1..477 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:57:06 Download gff for LP02725.complete
Subject Subject Range Query Range Percent Splice Strand
CG31698-RA 1..477 1..477 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:57:22 Download gff for LP02725.complete
Subject Subject Range Query Range Percent Splice Strand
CG31698-RA 15..491 1..477 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:18:42 Download gff for LP02725.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3173283..3173412 348..477 100 <- Minus
2L 3173480..3173826 1..347 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:18:42 Download gff for LP02725.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3173283..3173412 348..477 100 <- Minus
2L 3173480..3173826 1..347 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:18:42 Download gff for LP02725.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3173283..3173412 348..477 100 <- Minus
2L 3173480..3173826 1..347 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:54 Download gff for LP02725.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3173283..3173412 348..477 100 <- Minus
arm_2L 3173480..3173826 1..347 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:32:26 Download gff for LP02725.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3173480..3173826 1..347 100   Minus
2L 3173283..3173412 348..477 100 <- Minus

LP02725.hyp Sequence

Translation from 0 to 456

> LP02725.hyp
MRAIRVLLIFQLLACLMAVISGCNQGSCHPFIGLNKCNGNGYKEPKLPPR
DNACCGAHCVYNGPSCQNPGPCDSKPVNRCILDSHCGKGVAFYFVCKSDC
ELIKENEARQAAGYARLLSFSWGKQKCEGMNYKCGINCCCREYCPKRFCK
F*

LP02725.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:29:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG31698-PB 151 CG31698-PB 1..151 1..151 874 100 Plus
CG31698-PA 151 CG31698-PA 1..151 1..151 874 100 Plus

LP02725.pep Sequence

Translation from 1 to 456

> LP02725.pep
MRAIRVLLIFQLLACLMAVISGCNQGSCHPFIGLNKCNGNGYKEPKLPPR
DNACCGAHCVYNGPSCQNPGPCDSKPVNRCILDSHCGKGVAFYFVCKSDC
ELIKENEARQAAGYARLLSFSWGKQKCEGMNYKCGINCCCREYCPKRFCK
F*

LP02725.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:56:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20578-PA 169 GF20578-PA 1..163 1..151 333 48.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:56:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24455-PA 151 GG24455-PA 1..151 1..151 511 72.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG31698-PB 151 CG31698-PB 1..151 1..151 874 100 Plus
CG31698-PA 151 CG31698-PA 1..151 1..151 874 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26530-PA 149 GL26530-PA 1..149 1..151 355 52.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16404-PA 149 GA16404-PA 1..149 1..151 357 50 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:56:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18161-PA 151 GM18161-PA 1..151 1..151 712 90.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:56:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22771-PA 151 GD22771-PA 1..151 1..151 718 90.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:56:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19017-PA 157 GK19017-PA 28..153 24..150 242 40.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:56:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14929-PA 151 GE14929-PA 1..151 1..151 587 72.2 Plus