LP02725.complete Sequence
496 bp (496 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118992
> LP02725.complete
CATGAGAGCAATACGAGTTCTGCTGATTTTCCAACTGCTGGCTTGTCTAA
TGGCCGTAATATCGGGCTGCAACCAGGGGTCCTGCCATCCGTTCATTGGC
CTGAACAAGTGCAATGGTAATGGCTATAAGGAGCCCAAACTTCCACCTCG
GGATAACGCCTGCTGCGGTGCCCATTGCGTCTACAATGGTCCAAGTTGTC
AAAATCCCGGTCCCTGCGACAGCAAACCCGTGAATCGTTGCATCCTGGAC
TCACATTGTGGCAAAGGCGTAGCCTTCTACTTCGTATGCAAGTCAGATTG
TGAACTGATAAAGGAAAATGAAGCTCGCCAGGCAGCTGGATATGCCCGTC
TTCTTTCATTTTCGTGGGGCAAGCAGAAATGCGAGGGCATGAATTACAAA
TGCGGCATCAATTGTTGCTGTCGTGAGTATTGTCCTAAACGGTTTTGTAA
ATTTTAATGCGGTCAATAAAGGGTATTAAAAAAAAAAAAAAAAAAA
LP02725.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:44:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31698-RA | 551 | CG31698-RA | 27..511 | 1..485 | 2425 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:17:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 3173105..3173453 | 349..1 | 1730 | 99.7 | Minus |
chr2L | 23010047 | chr2L | 3172910..3173039 | 477..348 | 650 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:47:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:17:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3173478..3173826 | 349..1 | 1745 | 100 | Minus |
2L | 23513712 | 2L | 3173275..3173412 | 485..348 | 690 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:33:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3173478..3173826 | 349..1 | 1745 | 100 | Minus |
2L | 23513712 | 2L | 3173275..3173412 | 485..348 | 690 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 20:17:47 has no hits.
LP02725.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:18:42 Download gff for
LP02725.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 3172910..3173039 | 348..477 | 100 | <- | Minus |
chr2L | 3173107..3173453 | 1..347 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:12:32 Download gff for
LP02725.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31698-RA | 1..456 | 2..457 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:54 Download gff for
LP02725.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31698-RA | 1..456 | 2..457 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:57:06 Download gff for
LP02725.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31698-RA | 1..456 | 2..457 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:57:22 Download gff for
LP02725.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31698-RA | 1..456 | 2..457 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:07:25 Download gff for
LP02725.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31698-RA | 1..477 | 1..477 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:12:32 Download gff for
LP02725.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31698-RA | 1..477 | 1..477 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:54 Download gff for
LP02725.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31698-RA | 1..477 | 1..477 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:57:06 Download gff for
LP02725.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31698-RA | 1..477 | 1..477 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:57:22 Download gff for
LP02725.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31698-RA | 15..491 | 1..477 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:18:42 Download gff for
LP02725.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3173283..3173412 | 348..477 | 100 | <- | Minus |
2L | 3173480..3173826 | 1..347 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:18:42 Download gff for
LP02725.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3173283..3173412 | 348..477 | 100 | <- | Minus |
2L | 3173480..3173826 | 1..347 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:18:42 Download gff for
LP02725.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3173283..3173412 | 348..477 | 100 | <- | Minus |
2L | 3173480..3173826 | 1..347 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:54 Download gff for
LP02725.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 3173283..3173412 | 348..477 | 100 | <- | Minus |
arm_2L | 3173480..3173826 | 1..347 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:32:26 Download gff for
LP02725.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3173480..3173826 | 1..347 | 100 | | Minus |
2L | 3173283..3173412 | 348..477 | 100 | <- | Minus |
LP02725.hyp Sequence
Translation from 0 to 456
> LP02725.hyp
MRAIRVLLIFQLLACLMAVISGCNQGSCHPFIGLNKCNGNGYKEPKLPPR
DNACCGAHCVYNGPSCQNPGPCDSKPVNRCILDSHCGKGVAFYFVCKSDC
ELIKENEARQAAGYARLLSFSWGKQKCEGMNYKCGINCCCREYCPKRFCK
F*
LP02725.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:29:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31698-PB | 151 | CG31698-PB | 1..151 | 1..151 | 874 | 100 | Plus |
CG31698-PA | 151 | CG31698-PA | 1..151 | 1..151 | 874 | 100 | Plus |
LP02725.pep Sequence
Translation from 1 to 456
> LP02725.pep
MRAIRVLLIFQLLACLMAVISGCNQGSCHPFIGLNKCNGNGYKEPKLPPR
DNACCGAHCVYNGPSCQNPGPCDSKPVNRCILDSHCGKGVAFYFVCKSDC
ELIKENEARQAAGYARLLSFSWGKQKCEGMNYKCGINCCCREYCPKRFCK
F*
LP02725.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:56:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF20578-PA | 169 | GF20578-PA | 1..163 | 1..151 | 333 | 48.2 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:56:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG24455-PA | 151 | GG24455-PA | 1..151 | 1..151 | 511 | 72.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31698-PB | 151 | CG31698-PB | 1..151 | 1..151 | 874 | 100 | Plus |
CG31698-PA | 151 | CG31698-PA | 1..151 | 1..151 | 874 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:56:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL26530-PA | 149 | GL26530-PA | 1..149 | 1..151 | 355 | 52.3 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:56:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA16404-PA | 149 | GA16404-PA | 1..149 | 1..151 | 357 | 50 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:56:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM18161-PA | 151 | GM18161-PA | 1..151 | 1..151 | 712 | 90.1 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:56:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD22771-PA | 151 | GD22771-PA | 1..151 | 1..151 | 718 | 90.7 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:56:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK19017-PA | 157 | GK19017-PA | 28..153 | 24..150 | 242 | 40.9 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:56:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE14929-PA | 151 | GE14929-PA | 1..151 | 1..151 | 587 | 72.2 | Plus |