BDGP Sequence Production Resources |
Search the DGRC for LP02728
Library: | LP |
Tissue Source: | Drosophila melanogaster larval-early pupal |
Created by: | Ling Hong |
Date Registered: | 1998-06-11 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 27 |
Well: | 28 |
Vector: | pOT2 |
Associated Gene/Transcript | CG2147-RA |
Protein status: | LP02728.pep: gold |
Preliminary Size: | 921 |
Sequenced Size: | 764 |
Gene | Date | Evidence |
---|---|---|
CG2147 | 2001-01-01 | Release 2 assignment |
CG2147 | 2003-01-01 | Sim4 clustering to Release 3 |
CG2147 | 2003-02-22 | Blastp of sequenced clone |
CG2147 | 2008-04-29 | Release 5.5 accounting |
CG2147 | 2008-08-15 | Release 5.9 accounting |
CG2147 | 2008-12-18 | 5.12 accounting |
764 bp (764 high quality bases) assembled on 2003-02-22
GenBank Submission: AY069722
> LP02728.complete TTTTAGTGAAGCTAAAATCGTTTTGTTTCCGTTGTCAAAATCCAGCAGTG AGAAGGGAGCGGCACAATTAGAATAAAGAAGCCATCATGGATCCAACACC GCCGCTTCGTGCCACCAATAGTATTAACCCACAGCAGGTGGCAAGCGTTC CACCGCCACCGCCAACGGGGCAAATCATAGCTCCATCGGGAGCGTTTCCT GGATCCCTGACTCCCGGCTGGAATGACCCGCCACCCATTTCGGCGGATTC TCAGAGCTGCAAATTAAACAATAGTCGTCCACGCCTAGATCTTCGCAAGC GCGTGGCCCACCCGCTGGACGGGAAGTCCTCTAGTGTCCAGCTGGTTCAG CCACAACTATCAATACCTACAGCACAAGATTCAATCTCGCCGCGTCCCGT GGCCCTGGTAACACCCCAGCGCCAGATTCCATATCCGGATCCCAACAATC CACCGGCCGGTGGAGCGGATGTGGGCGGTTTCGGAGCGGGACCAAATGCC AATGCCGTGCGCCTGCCACCGTTGGCCCACAGCATCAGCATCGATCCCTC CAGGGTGGCCAAGGTTCCACCAAGAACCAAATAGCATGTAGTTATCGCCA ATTCAGGGCCTAGGCTAAGGAACTTCAAATTAATGTGTTCTATGGCGGGC TGGAAAATCAATTATTTTTCTATGTAAAACACTTAAGACACCTCACAAAA TACAATCAGAAATGCGAATGATGGGGGGACGGGACCTCTAAAAAGTAAAA AAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG2147-RA | 799 | CG2147-RA | 50..798 | 1..749 | 3745 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 8132497..8132697 | 1..201 | 100 | -> | Plus |
chrX | 8132752..8133296 | 202..746 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2147-RA | 1..498 | 87..584 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2147-RA | 1..498 | 87..584 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2147-RA | 1..498 | 87..584 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2147-RA | 1..498 | 87..584 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2147-RA | 1..498 | 87..584 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2147-RA | 1..746 | 1..746 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2147-RA | 1..746 | 1..746 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2147-RA | 1..746 | 1..746 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2147-RA | 1..746 | 1..746 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2147-RA | 1..746 | 1..746 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 8240684..8240884 | 1..201 | 100 | -> | Plus |
X | 8240939..8241483 | 202..746 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 8240684..8240884 | 1..201 | 100 | -> | Plus |
X | 8240939..8241483 | 202..746 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 8240684..8240884 | 1..201 | 100 | -> | Plus |
X | 8240939..8241483 | 202..746 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 8134717..8134917 | 1..201 | 100 | -> | Plus |
arm_X | 8134972..8135516 | 202..746 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 8248782..8248982 | 1..201 | 100 | -> | Plus |
X | 8249037..8249581 | 202..746 | 100 | Plus |
Translation from 86 to 583
> LP02728.pep MDPTPPLRATNSINPQQVASVPPPPPTGQIIAPSGAFPGSLTPGWNDPPP ISADSQSCKLNNSRPRLDLRKRVAHPLDGKSSSVQLVQPQLSIPTAQDSI SPRPVALVTPQRQIPYPDPNNPPAGGADVGGFGAGPNANAVRLPPLAHSI SIDPSRVAKVPPRTK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19372-PA | 174 | GF19372-PA | 23..174 | 23..165 | 287 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19307-PA | 167 | GG19307-PA | 1..167 | 1..165 | 594 | 79.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH12752-PA | 97 | GH12752-PA | 25..74 | 28..77 | 198 | 74 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG2147-PA | 165 | CG2147-PA | 1..165 | 1..165 | 877 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI15896-PA | 80 | GI15896-PA | 20..77 | 28..94 | 194 | 65.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14457-PA | 187 | GL14457-PA | 40..135 | 16..117 | 135 | 46.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11240-PA | 161 | GM11240-PA | 1..161 | 1..165 | 617 | 84.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD16888-PA | 161 | GD16888-PA | 1..161 | 1..165 | 605 | 83.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16645-PA | 92 | GJ16645-PA | 24..84 | 28..88 | 220 | 68.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10241-PA | 251 | GK10241-PA | 111..251 | 27..165 | 225 | 47.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE15772-PA | 167 | GE15772-PA | 1..167 | 1..165 | 487 | 81.4 | Plus |
Translation from 86 to 583
> LP02728.hyp MDPTPPLRATNSINPQQVASVPPPPPTGQIIAPSGAFPGSLTPGWNDPPP ISADSQSCKLNNSRPRLDLRKRVAHPLDGKSSSVQLVQPQLSIPTAQDSI SPRPVALVTPQRQIPYPDPNNPPAGGADVGGFGAGPNANAVRLPPLAHSI SIDPSRVAKVPPRTK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG2147-PA | 165 | CG2147-PA | 1..165 | 1..165 | 877 | 100 | Plus |