Clone LP02728 Report

Search the DGRC for LP02728

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:27
Well:28
Vector:pOT2
Associated Gene/TranscriptCG2147-RA
Protein status:LP02728.pep: gold
Preliminary Size:921
Sequenced Size:764

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2147 2001-01-01 Release 2 assignment
CG2147 2003-01-01 Sim4 clustering to Release 3
CG2147 2003-02-22 Blastp of sequenced clone
CG2147 2008-04-29 Release 5.5 accounting
CG2147 2008-08-15 Release 5.9 accounting
CG2147 2008-12-18 5.12 accounting

Clone Sequence Records

LP02728.complete Sequence

764 bp (764 high quality bases) assembled on 2003-02-22

GenBank Submission: AY069722

> LP02728.complete
TTTTAGTGAAGCTAAAATCGTTTTGTTTCCGTTGTCAAAATCCAGCAGTG
AGAAGGGAGCGGCACAATTAGAATAAAGAAGCCATCATGGATCCAACACC
GCCGCTTCGTGCCACCAATAGTATTAACCCACAGCAGGTGGCAAGCGTTC
CACCGCCACCGCCAACGGGGCAAATCATAGCTCCATCGGGAGCGTTTCCT
GGATCCCTGACTCCCGGCTGGAATGACCCGCCACCCATTTCGGCGGATTC
TCAGAGCTGCAAATTAAACAATAGTCGTCCACGCCTAGATCTTCGCAAGC
GCGTGGCCCACCCGCTGGACGGGAAGTCCTCTAGTGTCCAGCTGGTTCAG
CCACAACTATCAATACCTACAGCACAAGATTCAATCTCGCCGCGTCCCGT
GGCCCTGGTAACACCCCAGCGCCAGATTCCATATCCGGATCCCAACAATC
CACCGGCCGGTGGAGCGGATGTGGGCGGTTTCGGAGCGGGACCAAATGCC
AATGCCGTGCGCCTGCCACCGTTGGCCCACAGCATCAGCATCGATCCCTC
CAGGGTGGCCAAGGTTCCACCAAGAACCAAATAGCATGTAGTTATCGCCA
ATTCAGGGCCTAGGCTAAGGAACTTCAAATTAATGTGTTCTATGGCGGGC
TGGAAAATCAATTATTTTTCTATGTAAAACACTTAAGACACCTCACAAAA
TACAATCAGAAATGCGAATGATGGGGGGACGGGACCTCTAAAAAGTAAAA
AAAAAAAAAAAAAA

LP02728.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG2147-RA 799 CG2147-RA 50..798 1..749 3745 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:14:16
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8132751..8133296 201..746 2730 100 Plus
chrX 22417052 chrX 8132497..8132698 1..202 1010 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:47:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:14:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8240938..8241486 201..749 2745 100 Plus
X 23542271 X 8240684..8240885 1..202 1010 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8249036..8249584 201..749 2745 100 Plus
X 23527363 X 8248782..8248983 1..202 1010 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:14:14 has no hits.

LP02728.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:15:24 Download gff for LP02728.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8132497..8132697 1..201 100 -> Plus
chrX 8132752..8133296 202..746 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:34:07 Download gff for LP02728.complete
Subject Subject Range Query Range Percent Splice Strand
CG2147-RA 1..498 87..584 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:48:49 Download gff for LP02728.complete
Subject Subject Range Query Range Percent Splice Strand
CG2147-RA 1..498 87..584 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:56:34 Download gff for LP02728.complete
Subject Subject Range Query Range Percent Splice Strand
CG2147-RA 1..498 87..584 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:30:44 Download gff for LP02728.complete
Subject Subject Range Query Range Percent Splice Strand
CG2147-RA 1..498 87..584 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:30:08 Download gff for LP02728.complete
Subject Subject Range Query Range Percent Splice Strand
CG2147-RA 1..498 87..584 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:58:56 Download gff for LP02728.complete
Subject Subject Range Query Range Percent Splice Strand
CG2147-RA 1..746 1..746 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:48:49 Download gff for LP02728.complete
Subject Subject Range Query Range Percent Splice Strand
CG2147-RA 1..746 1..746 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:56:34 Download gff for LP02728.complete
Subject Subject Range Query Range Percent Splice Strand
CG2147-RA 1..746 1..746 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:30:45 Download gff for LP02728.complete
Subject Subject Range Query Range Percent Splice Strand
CG2147-RA 1..746 1..746 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:30:08 Download gff for LP02728.complete
Subject Subject Range Query Range Percent Splice Strand
CG2147-RA 1..746 1..746 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:15:24 Download gff for LP02728.complete
Subject Subject Range Query Range Percent Splice Strand
X 8240684..8240884 1..201 100 -> Plus
X 8240939..8241483 202..746 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:15:24 Download gff for LP02728.complete
Subject Subject Range Query Range Percent Splice Strand
X 8240684..8240884 1..201 100 -> Plus
X 8240939..8241483 202..746 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:15:24 Download gff for LP02728.complete
Subject Subject Range Query Range Percent Splice Strand
X 8240684..8240884 1..201 100 -> Plus
X 8240939..8241483 202..746 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:56:34 Download gff for LP02728.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8134717..8134917 1..201 100 -> Plus
arm_X 8134972..8135516 202..746 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:09:11 Download gff for LP02728.complete
Subject Subject Range Query Range Percent Splice Strand
X 8248782..8248982 1..201 100 -> Plus
X 8249037..8249581 202..746 100   Plus

LP02728.pep Sequence

Translation from 86 to 583

> LP02728.pep
MDPTPPLRATNSINPQQVASVPPPPPTGQIIAPSGAFPGSLTPGWNDPPP
ISADSQSCKLNNSRPRLDLRKRVAHPLDGKSSSVQLVQPQLSIPTAQDSI
SPRPVALVTPQRQIPYPDPNNPPAGGADVGGFGAGPNANAVRLPPLAHSI
SIDPSRVAKVPPRTK*

LP02728.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19372-PA 174 GF19372-PA 23..174 23..165 287 50 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19307-PA 167 GG19307-PA 1..167 1..165 594 79.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12752-PA 97 GH12752-PA 25..74 28..77 198 74 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG2147-PA 165 CG2147-PA 1..165 1..165 877 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15896-PA 80 GI15896-PA 20..77 28..94 194 65.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14457-PA 187 GL14457-PA 40..135 16..117 135 46.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11240-PA 161 GM11240-PA 1..161 1..165 617 84.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:48:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16888-PA 161 GD16888-PA 1..161 1..165 605 83.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:48:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16645-PA 92 GJ16645-PA 24..84 28..88 220 68.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:48:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10241-PA 251 GK10241-PA 111..251 27..165 225 47.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:48:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15772-PA 167 GE15772-PA 1..167 1..165 487 81.4 Plus

LP02728.hyp Sequence

Translation from 86 to 583

> LP02728.hyp
MDPTPPLRATNSINPQQVASVPPPPPTGQIIAPSGAFPGSLTPGWNDPPP
ISADSQSCKLNNSRPRLDLRKRVAHPLDGKSSSVQLVQPQLSIPTAQDSI
SPRPVALVTPQRQIPYPDPNNPPAGGADVGGFGAGPNANAVRLPPLAHSI
SIDPSRVAKVPPRTK*

LP02728.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG2147-PA 165 CG2147-PA 1..165 1..165 877 100 Plus