Clone LP02729 Report

Search the DGRC for LP02729

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:27
Well:29
Vector:pOT2
Associated Gene/TranscriptCG11816-RB
Protein status:LP02729.pep: gold
Preliminary Size:1054
Sequenced Size:1489

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11816 2002-01-01 Sim4 clustering to Release 2
CG11816 2003-01-01 Sim4 clustering to Release 3
CG11816 2008-04-29 Release 5.5 accounting
CG11816 2008-04-29 Picked prior to 5.5
CG11816 2008-08-15 Release 5.9 accounting
CG11816 2008-12-18 5.12 accounting

Clone Sequence Records

LP02729.complete Sequence

1489 bp assembled on 2007-10-25

GenBank Submission: BT031140

> LP02729.complete
AAAAGCGCCCGCAGACATGTCATCAAACAGAATCCGGCCGGAGTTGGTAC
TCCTGCAGCTGCTGCTACTGGCGGCCACATTAATCCCTTTGCTGCAGGCC
GGGATAGTTACAGCTCCGTACTCCGAATCGGATTCGGATTTGGATTCGAA
TCCGGACACCACCGCCACCACCATCGCCACCATCGCCACCATCACCACCG
ACAACTACAACCCGCATGCGGAGGAGCTGCAACTGGAATCGGAGACGGAG
GCCACTGCTGCTCAAGTGGATGGCCAACGCATCGACTGCAAATTGACTTT
CGATGCGGCGACAATGGACTCGTTAGGCTGCCACAATGAGGGGGCGTTGC
CGGAGAGGGGGGCGTTACCAGGCAGTGGTAATAAGCCGGTGGAGGAGATG
CCTGAGGCAAATCCAGACTGGCGGCGCCACTTGAAGTCACCGGACAGCCA
GCCCATCTATGAATTACAATTGGTTGTTTGGCCCAGTGACATCGAGGACG
GTGATGACTTCAGTCCACCGCTGTCCACTACAACAACAACAGAAGCAACA
ACAACGACAGCTAGGACCACTAGAGCCACCAGTAGCACCACTAGCATCAC
CCCCAAGCCCACCCAAATTGGGACACCTATTGAGCAAATATGGCCATTGT
ACGAGGATCAATTGGTTGTATTTCCGCAAATGGACTTTGAAGAGGAGAAT
CTTGATTATTTCTTCGACGAAGTGCCACCATCCACATCGTCGACCACCGG
TCGCCCGTTGACCACCAGTCATCCCACCGGCACGCCCACTCCCACGCCCA
TTTATGTTGTGCAAAACTATCACGTTATACACCCCAATGGCACCGAGGAG
TACAAATTGGTGATGAGCAACGGCCTGGTGAACTACAAGAAGCTGTACTC
CAAGAAAGTGGGTGACCGGTTGATCAACGTTCAGGAGGGCTACAATTCAG
TGCCCATTCCAGGACCTAAAAACCAAATCCAGACACAGTACTATATTGCC
GACGAGCGGGGCTACAATGTCTATAGAATCGAGCTCCACTATCACCAGCC
AGGGTTGTTGCCCAAACATTTGCATTACAAAGCCACAAAAGCGACCAATA
TGTGAATGAGGATGGGCAGGATTTCCAGTTGGCGGCACAGTGGTGCTAAC
CACTAAGTAAACATATATATATTTTTTTTGCATTTTTTTTTTATAACTTA
TTTTAGCTGAAGAGTTTCCAATAAATTGTAAAGAAAACTTGTATTTTTAT
TTAGTGTTTGCATGTGAAATTAAACAAGATTTTTTAAATAGTTTAAACTG
GCATATATACGCAGATATATTTGTATCTTTTGCTTGTGAGTTAAGTTTTT
AATTTCAGCTGTGCTTGCATATAGTTATAAAATGTATAAGTATTTGTTTA
TTATAATTTTTCGACCCAAGGTTCACTTTGTTGGGTGCAAAAAAATGGCG
AAATAAAATGTAGAGCCCACAAAAAAAAAAAAAAAAAAA

LP02729.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:35:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG11816.a 1623 CG11816.a 154..1623 1..1470 7350 100 Plus
CG11816.b 1322 CG11816.b 3..1030 1..1028 5140 100 Plus
CG11816-RA 1111 CG11816-RA 3..1030 1..1028 5140 100 Plus
CG11816.b 1322 CG11816.b 1122..1322 1029..1229 1005 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:22:38
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 13444142..13444996 855..1 4275 100 Minus
chrX 22417052 chrX 13443287..13443731 1470..1029 2130 99.1 Minus
chrX 22417052 chrX 13443823..13443995 1028..856 865 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:47:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:22:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13553411..13554265 855..1 4275 100 Minus
X 23542271 X 13552555..13553000 1474..1029 2230 100 Minus
X 23542271 X 13553092..13553264 1028..856 865 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:32:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13561509..13562363 855..1 4275 100 Minus
X 23527363 X 13560653..13561098 1474..1029 2230 100 Minus
X 23527363 X 13561190..13561362 1028..856 865 100 Minus
Blast to na_te.dros performed 2019-03-16 08:22:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2304..2407 512..617 164 64.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1503..1619 511..631 162 62.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2442..2526 528..613 157 66.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2799..2910 531..644 141 60.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2322..2410 515..605 134 63.7 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 1182..1275 1412..1317 133 62.9 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2466..2552 531..618 131 62.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2385..2468 525..606 127 63.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 5629..5675 511..557 127 74.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2865..2944 531..611 123 64.6 Plus
Doc3-element 4740 Doc3-element DOC3 4740bp 504..583 519..599 123 63 Plus
roo 9092 roo DM_ROO 9092bp 1124..1160 525..561 122 81.1 Plus
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 1771..1823 1249..1303 117 70.9 Plus

LP02729.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:23:39 Download gff for LP02729.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 13443287..13443731 1029..1470 99 <- Minus
chrX 13443823..13443995 856..1028 100 <- Minus
chrX 13444142..13444996 1..855 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:34:08 Download gff for LP02729.complete
Subject Subject Range Query Range Percent Splice Strand
CG11816-RA 1..1017 17..1033 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:05:15 Download gff for LP02729.complete
Subject Subject Range Query Range Percent Splice Strand
CG11816-RA 1..1017 17..1033 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:51:18 Download gff for LP02729.complete
Subject Subject Range Query Range Percent Splice Strand
CG11816-RD 1..1089 17..1105 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:51:33 Download gff for LP02729.complete
Subject Subject Range Query Range Percent Splice Strand
CG11816-RA 1..1017 17..1033 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:39:08 Download gff for LP02729.complete
Subject Subject Range Query Range Percent Splice Strand
CG11816-RD 1..1089 17..1105 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:58:12 Download gff for LP02729.complete
Subject Subject Range Query Range Percent Splice Strand
CG11816-RA 1..1033 1..1033 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:05:14 Download gff for LP02729.complete
Subject Subject Range Query Range Percent Splice Strand
CG11816-RA 1..1033 1..1033 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:51:18 Download gff for LP02729.complete
Subject Subject Range Query Range Percent Splice Strand
CG11816-RD 489..1958 1..1470 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:51:33 Download gff for LP02729.complete
Subject Subject Range Query Range Percent Splice Strand
CG11816-RA 1..1033 1..1033 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:39:08 Download gff for LP02729.complete
Subject Subject Range Query Range Percent Splice Strand
CG11816-RD 489..1958 1..1470 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:23:39 Download gff for LP02729.complete
Subject Subject Range Query Range Percent Splice Strand
X 13553092..13553264 856..1028 100 <- Minus
X 13552559..13553000 1029..1470 100 <- Minus
X 13553411..13554265 1..855 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:23:39 Download gff for LP02729.complete
Subject Subject Range Query Range Percent Splice Strand
X 13553092..13553264 856..1028 100 <- Minus
X 13552559..13553000 1029..1470 100 <- Minus
X 13553411..13554265 1..855 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:23:39 Download gff for LP02729.complete
Subject Subject Range Query Range Percent Splice Strand
X 13553092..13553264 856..1028 100 <- Minus
X 13552559..13553000 1029..1470 100 <- Minus
X 13553411..13554265 1..855 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:51:18 Download gff for LP02729.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13446592..13447033 1029..1470 100 <- Minus
arm_X 13447125..13447297 856..1028 100 <- Minus
arm_X 13447444..13448298 1..855 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:57:23 Download gff for LP02729.complete
Subject Subject Range Query Range Percent Splice Strand
X 13560657..13561098 1029..1470 100 <- Minus
X 13561190..13561362 856..1028 100 <- Minus
X 13561509..13562363 1..855 100   Minus

LP02729.hyp Sequence

Translation from 0 to 1104

> LP02729.hyp
KAPADMSSNRIRPELVLLQLLLLAATLIPLLQAGIVTAPYSESDSDLDSN
PDTTATTIATIATITTDNYNPHAEELQLESETEATAAQVDGQRIDCKLTF
DAATMDSLGCHNEGALPERGALPGSGNKPVEEMPEANPDWRRHLKSPDSQ
PIYELQLVVWPSDIEDGDDFSPPLSTTTTTEATTTTARTTRATSSTTSIT
PKPTQIGTPIEQIWPLYEDQLVVFPQMDFEEENLDYFFDEVPPSTSSTTG
RPLTTSHPTGTPTPTPIYVVQNYHVIHPNGTEEYKLVMSNGLVNYKKLYS
KKVGDRLINVQEGYNSVPIPGPKNQIQTQYYIADERGYNVYRIELHYHQP
GLLPKHLHYKATKATNM*

LP02729.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG11816-PB 362 CG11816-PB 1..362 6..367 1911 100 Plus
CG11816-PD 362 CG11816-PD 1..362 6..367 1911 100 Plus
CG11816-PC 346 CG11816-PC 1..339 6..344 1774 99.7 Plus
CG11816-PA 346 CG11816-PA 1..339 6..344 1774 99.7 Plus

LP02729.pep Sequence

Translation from 1 to 1104

> LP02729.pep
KAPADMSSNRIRPELVLLQLLLLAATLIPLLQAGIVTAPYSESDSDLDSN
PDTTATTIATIATITTDNYNPHAEELQLESETEATAAQVDGQRIDCKLTF
DAATMDSLGCHNEGALPERGALPGSGNKPVEEMPEANPDWRRHLKSPDSQ
PIYELQLVVWPSDIEDGDDFSPPLSTTTTTEATTTTARTTRATSSTTSIT
PKPTQIGTPIEQIWPLYEDQLVVFPQMDFEEENLDYFFDEVPPSTSSTTG
RPLTTSHPTGTPTPTPIYVVQNYHVIHPNGTEEYKLVMSNGLVNYKKLYS
KKVGDRLINVQEGYNSVPIPGPKNQIQTQYYIADERGYNVYRIELHYHQP
GLLPKHLHYKATKATNM*

LP02729.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:59:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22377-PA 390 GF22377-PA 1..335 6..345 856 61 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:59:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19502-PA 274 GG19502-PA 88..268 161..345 634 77.8 Plus
Dere\GG19502-PA 274 GG19502-PA 1..85 6..89 208 76.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12248-PA 357 GH12248-PA 63..331 94..344 542 46.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG11816-PB 362 CG11816-PB 1..362 6..367 1911 100 Plus
CG11816-PD 362 CG11816-PD 1..362 6..367 1911 100 Plus
CG11816-PC 346 CG11816-PC 1..339 6..344 1774 99.7 Plus
CG11816-PA 346 CG11816-PA 1..339 6..344 1774 99.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15781-PA 364 GI15781-PA 54..343 78..344 507 47.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20325-PA 323 GL20325-PA 1..323 6..367 857 55.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11215-PA 482 GA11215-PA 1..313 6..342 790 53.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17607-PA 299 GM17607-PA 1..289 6..299 1052 89.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:59:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24522-PA 341 GD24522-PA 1..335 6..345 1688 95 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:59:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18638-PA 353 GJ18638-PA 61..346 93..364 608 52.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:59:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19786-PA 326 GK19786-PA 20..324 73..361 567 47.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16154-PA 376 GE16154-PA 1..359 6..345 1083 73.8 Plus