Clone LP02760 Report

Search the DGRC for LP02760

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:27
Well:60
Vector:pOT2
Associated Gene/TranscriptSyx8-RA
Protein status:LP02760.pep: gold
Preliminary Size:755
Sequenced Size:940

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4109 2002-01-01 Sim4 clustering to Release 2
CG4109 2003-01-01 Sim4 clustering to Release 3
CG4109 2003-08-11 Blastp of sequenced clone
Syx8 2008-04-29 Release 5.5 accounting
Syx8 2008-08-15 Release 5.9 accounting
Syx8 2008-12-18 5.12 accounting

Clone Sequence Records

LP02760.complete Sequence

940 bp (940 high quality bases) assembled on 2003-08-11

GenBank Submission: BT011107

> LP02760.complete
ATTGCTGGAGGCGTAGTTTTCTGCTTTTGATAATTACTCATAGCAAAAGC
AGAGAAATGGCGCTGGTGGATCACGATTCCTGGGACATCGAGTACGAGGG
CTGCGAGCGACTGCGGCATCAGCTGCTGGTATACCTCAACCAGCGGCAGC
AGCTCAATCCGAGGACGAGCCAGTTCGTCCAACTGACAAGCAGCATTCAG
ACGGGAATAGAGCAGCTGGCCAAGGACATGAAGCACCTCAAGGTGGTGCT
GGACAACGCCATCACCTGGGAGACGAGCCCGGAGGAGGAGCTGCAACAGC
GGCGCATCGACTGGGATAGACTTACTTCGCAGCTGCGCGAGATCCGCGAG
AAGTTCGCAAACAGTAGCCGCTCCAATGTCCCGGCCGCATCCGGTTCTGC
TTGGCAGGATCAGGATCTCGGCCCAGGTCACAGCAATTCCTCGCGGAATA
CCGCCTTGGATGTGGAGGCTCTGAAGCAGAAAAAGACCGAGATGCTGGCG
CAGCAGAACGAAGGACTCGAGGTTCTATCAGCCACATTGTCCAGACAGCG
CCAACTGGCCACACAGCTGGGCAACGAGGTGGAGGACCAGAACAATATCC
TTGACAACTTGGCCAATGCCATGGACCGTGTGGAAACGGGTGTGCAGCGG
GAAACACAGAGCATTGGACAGGTTAACCGGCGGGACAGTACCTGGGGCTA
CTGGCTCGTCATCATAGCCTTGTTCGTCGCCATCATTGTCGTGGTCTTCG
TCTAGCTCCCACGATCCATTCCAGTTGTTATACTACTTTATACTATGACC
TGCGTGGAATGTCTATCTGTTAACCCAAAGTTTGATTATTTATGTATACA
CCAATTAAAGTAGGATTTATAAGTAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LP02760.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
Syx8-RA 1012 Syx8-RA 145..1012 1..868 4340 100 Plus
CG4169-RA 1789 CG4169-RA 1740..1789 875..826 250 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:59:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16576210..16576803 594..1 2955 99.8 Minus
chr3L 24539361 chr3L 16575877..16576156 874..595 1400 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:47:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:59:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16586441..16587034 594..1 2970 100 Minus
3L 28110227 3L 16586107..16586387 875..595 1405 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16579541..16580134 594..1 2970 100 Minus
3L 28103327 3L 16579207..16579487 875..595 1405 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:59:06 has no hits.

LP02760.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:59:53 Download gff for LP02760.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16575877..16576156 595..874 100 <- Minus
chr3L 16576210..16576803 1..594 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:34:11 Download gff for LP02760.complete
Subject Subject Range Query Range Percent Splice Strand
Syx8-RA 1..699 57..755 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:52:54 Download gff for LP02760.complete
Subject Subject Range Query Range Percent Splice Strand
Syx8-RA 1..699 57..755 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:04:27 Download gff for LP02760.complete
Subject Subject Range Query Range Percent Splice Strand
Syx8-RA 1..699 57..755 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:18:31 Download gff for LP02760.complete
Subject Subject Range Query Range Percent Splice Strand
Syx8-RA 1..699 57..755 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:11:55 Download gff for LP02760.complete
Subject Subject Range Query Range Percent Splice Strand
Syx8-RA 1..699 57..755 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:16:25 Download gff for LP02760.complete
Subject Subject Range Query Range Percent Splice Strand
Syx8-RA 66..820 1..755 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:52:54 Download gff for LP02760.complete
Subject Subject Range Query Range Percent Splice Strand
Syx8-RA 66..939 1..874 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:04:27 Download gff for LP02760.complete
Subject Subject Range Query Range Percent Splice Strand
Syx8-RA 24..897 1..874 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:18:31 Download gff for LP02760.complete
Subject Subject Range Query Range Percent Splice Strand
Syx8-RA 66..820 1..755 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:11:55 Download gff for LP02760.complete
Subject Subject Range Query Range Percent Splice Strand
Syx8-RA 24..897 1..874 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:59:53 Download gff for LP02760.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16586108..16586387 595..874 100 <- Minus
3L 16586441..16587034 1..594 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:59:53 Download gff for LP02760.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16586108..16586387 595..874 100 <- Minus
3L 16586441..16587034 1..594 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:59:53 Download gff for LP02760.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16586108..16586387 595..874 100 <- Minus
3L 16586441..16587034 1..594 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:04:27 Download gff for LP02760.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16579208..16579487 595..874 100 <- Minus
arm_3L 16579541..16580134 1..594 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:52:44 Download gff for LP02760.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16579208..16579487 595..874 100 <- Minus
3L 16579541..16580134 1..594 100   Minus

LP02760.hyp Sequence

Translation from 2 to 754

> LP02760.hyp
CWRRSFLLLIITHSKSREMALVDHDSWDIEYEGCERLRHQLLVYLNQRQQ
LNPRTSQFVQLTSSIQTGIEQLAKDMKHLKVVLDNAITWETSPEEELQQR
RIDWDRLTSQLREIREKFANSSRSNVPAASGSAWQDQDLGPGHSNSSRNT
ALDVEALKQKKTEMLAQQNEGLEVLSATLSRQRQLATQLGNEVEDQNNIL
DNLANAMDRVETGVQRETQSIGQVNRRDSTWGYWLVIIALFVAIIVVVFV
*

LP02760.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:15:20
Subject Length Description Subject Range Query Range Score Percent Strand
Syx8-PA 232 CG4109-PA 1..232 19..250 1178 100 Plus

LP02760.pep Sequence

Translation from 56 to 754

> LP02760.pep
MALVDHDSWDIEYEGCERLRHQLLVYLNQRQQLNPRTSQFVQLTSSIQTG
IEQLAKDMKHLKVVLDNAITWETSPEEELQQRRIDWDRLTSQLREIREKF
ANSSRSNVPAASGSAWQDQDLGPGHSNSSRNTALDVEALKQKKTEMLAQQ
NEGLEVLSATLSRQRQLATQLGNEVEDQNNILDNLANAMDRVETGVQRET
QSIGQVNRRDSTWGYWLVIIALFVAIIVVVFV*

LP02760.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10519-PA 229 GF10519-PA 1..229 1..232 926 76.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15870-PA 232 GG15870-PA 1..232 1..232 1118 92.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15579-PA 235 GH15579-PA 1..235 1..232 748 63.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
Syx8-PA 232 CG4109-PA 1..232 1..232 1178 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16855-PA 227 GI16855-PA 1..227 1..232 654 58.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17980-PA 230 GL17980-PA 1..230 1..232 936 78.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:18:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17964-PA 230 GA17964-PA 1..230 1..232 936 78.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:18:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24388-PA 232 GM24388-PA 1..232 1..232 1149 94.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:18:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12459-PA 232 GD12459-PA 1..232 1..232 1176 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:18:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12605-PA 229 GJ12605-PA 1..229 1..232 754 63.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11384-PA 239 GK11384-PA 1..229 1..222 679 59.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22209-PA 232 GE22209-PA 1..222 1..222 1082 93.7 Plus