Clone LP02768 Report

Search the DGRC for LP02768

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:27
Well:68
Vector:pOT2
Associated Gene/Transcriptslv-RA
Protein status:LP02768.pep: gold
Preliminary Size:1243
Sequenced Size:990

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8717 2002-01-01 Sim4 clustering to Release 2
CG8717 2002-05-18 Blastp of sequenced clone
CG8717 2003-01-01 Sim4 clustering to Release 3
slv 2008-04-29 Release 5.5 accounting
slv 2008-08-15 Release 5.9 accounting
slv 2008-12-18 5.12 accounting

Clone Sequence Records

LP02768.complete Sequence

990 bp (990 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118993

> LP02768.complete
ATTGATCGCTATGTCGGCGGTGGCCTACGACTCACTGCTGTCAACGACGG
CGGTGATCAGCACCGTCTTCCAGTTCCTCTCCGGCGCCATGATATGCCGA
AAGTACATCCAGAAGAAAAGCACGGGGGACTCTTCCGGAGTTCCCTTCAT
ATGCGGATTCTTATCGTGCAGCTTTTGGTTGCGCTACGGTGTCTTAACCA
ACGAGCAGAGCATTGTGCTGGTCAACATCATCGGATCGACGCTCTTTCTG
GTCTACACGCTGATCTACTATGTGTTTACCGTCAACAAACGTGCCTGTGT
AAAGCAGTTTGGGTTTGTTCTGACTGTTCTGGTGGTGGTCATTGTCTACA
CCAATCGGCTGGAAGATCAGCGCGATCGAATGATACACGTCACAGGAATT
GTGTGCTGCATCGTGACCGTGTGTTTCTTCGCCGCCCCGCTGGCTAGCTT
GCTGCATGTGATACGGGCGAAGAACTCCGAGAGCCTTCCCCTGCCTCTGA
TAGCCACGTCCTTCGTGGTCAGCCTGCAGTGGCTTATCTACGGTATACTG
ATATCGGACTCATTTATCCAGATTCCCAACTTTCTGGGCTGCATACTGTC
GCTGCTGCAGTTGGGTCTGTTCGTCCTCTACCCGCCGCGAAGCTACTCCG
GCCACGGCTACAAGCTGGTCGAACAGGCAGTGCCGTTTTAGGCAGCTAAT
CGGACCAAGCCACGCATTTCGCTTTGGCCTCCGAGCGTGCCGCACACAGG
GTTTATACATACATGCTGCTTGCTTAGGCGCCAGGCTTATTTACTATAGA
CATACGTAAAAGTAAGCCTATATTTATTGTAAAGTATTTATTTAATCCCG
AGGATTTGCCTCGAATATGCCGCTACTTACGTTGCCTTGCTGTTCGGTGG
CGCCCATTTAATTGTACCCTTTAGAGCCCGTATTCCTAATAAACGAACAC
ACGGGAAACGATTGAGTAACCGAAAAAAAAAAAAAAAAAA

LP02768.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:02:28
Subject Length Description Subject Range Query Range Score Percent Strand
slv-RA 1298 slv-RA 303..1276 1..974 4870 100 Plus
sut1.a 1618 sut1.a 1..69 949..881 345 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:46:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3967978..3968381 972..569 2020 100 Minus
chr2R 21145070 chr2R 3968692..3968922 396..166 1155 100 Minus
chr2R 21145070 chr2R 3968450..3968628 571..393 895 100 Minus
chr2R 21145070 chr2R 3969434..3969520 87..1 435 100 Minus
chr2R 21145070 chr2R 3969279..3969358 167..88 400 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:47:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:46:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8080557..8080962 974..569 2030 100 Minus
2R 25286936 2R 8081273..8081503 396..166 1155 100 Minus
2R 25286936 2R 8081031..8081209 571..393 895 100 Minus
2R 25286936 2R 8082015..8082101 87..1 435 100 Minus
2R 25286936 2R 8081860..8081939 167..88 400 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:34:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8081756..8082161 974..569 2030 100 Minus
2R 25260384 2R 8082472..8082702 396..166 1155 100 Minus
2R 25260384 2R 8082230..8082408 571..393 895 100 Minus
2R 25260384 2R 8083214..8083300 87..1 435 100 Minus
2R 25260384 2R 8083059..8083138 167..88 400 100 Minus
Blast to na_te.dros performed on 2019-03-16 20:46:23 has no hits.

LP02768.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:47:23 Download gff for LP02768.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3969434..3969520 1..87 100   Minus
chr2R 3967978..3968378 572..972 100 <- Minus
chr2R 3968450..3968625 396..571 100 <- Minus
chr2R 3968693..3968922 166..395 100 <- Minus
chr2R 3969281..3969358 88..165 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:34:12 Download gff for LP02768.complete
Subject Subject Range Query Range Percent Splice Strand
slv-RA 1..681 11..691 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:43:32 Download gff for LP02768.complete
Subject Subject Range Query Range Percent Splice Strand
slv-RA 1..681 11..691 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:28:00 Download gff for LP02768.complete
Subject Subject Range Query Range Percent Splice Strand
slv-RA 1..681 11..691 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:35:39 Download gff for LP02768.complete
Subject Subject Range Query Range Percent Splice Strand
slv-RA 1..681 11..691 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:53:12 Download gff for LP02768.complete
Subject Subject Range Query Range Percent Splice Strand
slv-RA 1..681 11..691 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:18:06 Download gff for LP02768.complete
Subject Subject Range Query Range Percent Splice Strand
slv-RA 270..1241 1..972 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:43:32 Download gff for LP02768.complete
Subject Subject Range Query Range Percent Splice Strand
slv-RA 270..1241 1..972 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:28:00 Download gff for LP02768.complete
Subject Subject Range Query Range Percent Splice Strand
slv-RA 120..1091 1..972 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:35:39 Download gff for LP02768.complete
Subject Subject Range Query Range Percent Splice Strand
slv-RA 270..1241 1..972 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:53:12 Download gff for LP02768.complete
Subject Subject Range Query Range Percent Splice Strand
slv-RA 120..1091 1..972 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:47:23 Download gff for LP02768.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8080559..8080959 572..972 100 <- Minus
2R 8081031..8081206 396..571 100 <- Minus
2R 8081274..8081503 166..395 100 <- Minus
2R 8081862..8081939 88..165 100 <- Minus
2R 8082015..8082101 1..87 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:47:23 Download gff for LP02768.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8080559..8080959 572..972 100 <- Minus
2R 8081031..8081206 396..571 100 <- Minus
2R 8081274..8081503 166..395 100 <- Minus
2R 8081862..8081939 88..165 100 <- Minus
2R 8082015..8082101 1..87 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:47:23 Download gff for LP02768.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8080559..8080959 572..972 100 <- Minus
2R 8081031..8081206 396..571 100 <- Minus
2R 8081274..8081503 166..395 100 <- Minus
2R 8081862..8081939 88..165 100 <- Minus
2R 8082015..8082101 1..87 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:28:00 Download gff for LP02768.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3968779..3969008 166..395 100 <- Minus
arm_2R 3969367..3969444 88..165 100 <- Minus
arm_2R 3968064..3968464 572..972 100 <- Minus
arm_2R 3968536..3968711 396..571 100 <- Minus
arm_2R 3969520..3969606 1..87 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:08:04 Download gff for LP02768.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8081758..8082158 572..972 100 <- Minus
2R 8082230..8082405 396..571 100 <- Minus
2R 8082473..8082702 166..395 100 <- Minus
2R 8083061..8083138 88..165 100 <- Minus
2R 8083214..8083300 1..87 100   Minus

LP02768.hyp Sequence

Translation from 0 to 690

> LP02768.hyp
LIAMSAVAYDSLLSTTAVISTVFQFLSGAMICRKYIQKKSTGDSSGVPFI
CGFLSCSFWLRYGVLTNEQSIVLVNIIGSTLFLVYTLIYYVFTVNKRACV
KQFGFVLTVLVVVIVYTNRLEDQRDRMIHVTGIVCCIVTVCFFAAPLASL
LHVIRAKNSESLPLPLIATSFVVSLQWLIYGILISDSFIQIPNFLGCILS
LLQLGLFVLYPPRSYSGHGYKLVEQAVPF*

LP02768.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
slv-PC 226 CG8717-PC 1..226 4..229 1151 100 Plus
slv-PB 226 CG8717-PB 1..226 4..229 1151 100 Plus
slv-PA 226 CG8717-PA 1..226 4..229 1151 100 Plus
CG7272-PA 228 CG7272-PA 11..213 9..211 212 27.2 Plus

LP02768.pep Sequence

Translation from 10 to 690

> LP02768.pep
MSAVAYDSLLSTTAVISTVFQFLSGAMICRKYIQKKSTGDSSGVPFICGF
LSCSFWLRYGVLTNEQSIVLVNIIGSTLFLVYTLIYYVFTVNKRACVKQF
GFVLTVLVVVIVYTNRLEDQRDRMIHVTGIVCCIVTVCFFAAPLASLLHV
IRAKNSESLPLPLIATSFVVSLQWLIYGILISDSFIQIPNFLGCILSLLQ
LGLFVLYPPRSYSGHGYKLVEQAVPF*

LP02768.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:07:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11215-PA 226 GF11215-PA 1..226 1..226 1042 92.9 Plus
Dana\GF23701-PA 228 GF23701-PA 11..213 6..208 205 27.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:07:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10680-PA 226 GG10680-PA 1..226 1..226 1157 98.7 Plus
Dere\GG15900-PA 228 GG15900-PA 11..213 6..208 183 28.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:07:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19991-PA 225 GH19991-PA 2..225 3..226 1031 87.5 Plus
Dgri\GH14541-PA 232 GH14541-PA 11..213 6..208 199 28.6 Plus
Dgri\GH13950-PA 232 GH13950-PA 11..213 6..208 195 28.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:34
Subject Length Description Subject Range Query Range Score Percent Strand
slv-PC 226 CG8717-PC 1..226 1..226 1151 100 Plus
slv-PB 226 CG8717-PB 1..226 1..226 1151 100 Plus
slv-PA 226 CG8717-PA 1..226 1..226 1151 100 Plus
CG7272-PA 228 CG7272-PA 11..213 6..208 212 27.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:07:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20166-PA 227 GI20166-PA 2..227 3..226 947 85.4 Plus
Dmoj\GI13112-PA 230 GI13112-PA 23..213 18..208 201 29.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:07:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10598-PA 225 GL10598-PA 1..225 1..226 1060 89.8 Plus
Dper\GL24812-PA 231 GL24812-PA 11..213 6..208 165 27.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:07:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21278-PA 226 GA21278-PA 1..226 1..226 1011 89.4 Plus
Dpse\GA20227-PA 231 GA20227-PA 11..213 6..208 165 27.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:07:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20727-PA 226 GM20727-PA 1..226 1..226 1163 99.6 Plus
Dsec\GM25529-PA 228 GM25529-PA 11..215 6..210 175 27.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:07:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10194-PA 226 GD10194-PA 1..226 1..226 1163 99.6 Plus
Dsim\GD10193-PA 168 GD10193-PA 1..164 1..165 737 88.5 Plus
Dsim\GD14544-PA 228 GD14544-PA 11..215 6..210 178 27.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:07:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20230-PA 225 GJ20230-PA 2..225 3..226 945 84.8 Plus
Dvir\GJ13859-PA 229 GJ13859-PA 11..213 6..208 222 31.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:07:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23163-PA 226 GK23163-PA 1..226 1..226 990 82.7 Plus
Dwil\GK20413-PA 231 GK20413-PA 11..213 6..208 214 28.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:07:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23345-PA 226 GE23345-PA 1..226 1..226 1137 97.3 Plus
Dyak\GE22241-PA 228 GE22241-PA 11..215 6..210 172 27.9 Plus
Dyak\GE23145-PA 228 GE23145-PA 11..215 6..210 170 28.4 Plus