Clone LP02810 Report

Search the DGRC for LP02810

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:28
Well:10
Vector:pOT2
Associated Gene/TranscriptCG11635-RA
Protein status:LP02810.pep: gold
Sequenced Size:952

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11635 2002-01-01 Sim4 clustering to Release 2
CG11635 2003-01-01 Sim4 clustering to Release 3
CG11635 2004-12-02 Blastp of sequenced clone
CG11635 2008-04-29 Release 5.5 accounting
CG11635 2008-08-15 Release 5.9 accounting
CG11635 2008-12-18 5.12 accounting

Clone Sequence Records

LP02810.complete Sequence

952 bp (952 high quality bases) assembled on 2004-12-02

GenBank Submission: BT021373

> LP02810.complete
CGATTCATGTAACGGCGTTACGGTATACAAAAATTTTCAAAATTCCACTT
TCATTAAAAGTTTCGGCTAATGTTTTGGTCCTCCCTACTAAGGGGCTTCA
GCTCACGTCAGAGCGGCTCCTCGAATAAACCCCCAAAACCTCCAAGTCCA
CCGAAGCCACCATCGTCACCATCTCCACCAAAGTCTCCTTCTGCCAAACG
AGAATGCAAGATCCGGACGCACTGCATTCCGGCCGCCTTCTGCGCCGAAG
GGGATAAGTTCAAGTCGATGTGGGATCCGCCGAAGAACCTGCCTCCGCCG
TACCCCTTCGTGGTCAGCCGATCAAATGACTTGTGCTGCGAACCCAACTG
CACCAAACCACTGCCCTCATTCGACGAGCTGTATTACCGTCCCTCCTGCA
AGAACGGTCCTTACCAGCGCCACTGGGTGGAGTGCCCCAAGTTCATGATC
CGCAAGAAGATAATCTGCGCCTACGACAAGCTGGAGGCTCTGAGCCCCGC
CCGTCGGGTGGCCGAGCGGCGCGAGCGGACAACGCTCAGTGCCACAGCCA
CAGGACCATGTCCCCATTTCGCTCCGTTGGCACGATGCGTGCCAGGACGT
CGTCCGCCCAGATGCCACGCGGCCAAGACGCCCTCCTGCTGCCGCAGGTT
GTGTGCACCGATGCCCTGCTGGTCGGATTGTAAGCAGCCTAAGCTGGCCA
AGCGACCATATCGACCTCGCGAGTGCGAGTGCCGATTCCCCCTGAGCCTC
TGCGAAGCGGAGCGGGGTCGTCAGTGGGTCAAAATTCATGGTGAGAACCA
CGTCTGTCCCAGTGCCATAAAAAAGGCCAAGAAGGCGAGAAAAGACATGC
TCAAGAAGATGAAAAAGGATAAGAAGGATAAGGGCACGGATAAGAAGAAA
GATAAGAACAAGGATAAAAATAAAAAATAAGTTTTAAAAAAAAAAAAAAA
AA

LP02810.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:52:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG11635-RA 1342 CG11635-RA 413..1342 1..930 4650 100 Plus
spaw-RA 2243 spaw-RA 1716..2243 938..411 2640 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:11:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4246061..4246995 1..935 4630 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:47:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:10:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8358538..8359475 1..938 4690 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8359737..8360674 1..938 4690 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:11:00 has no hits.

LP02810.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:11:47 Download gff for LP02810.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4246061..4246912 1..852 99 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:34:15 Download gff for LP02810.complete
Subject Subject Range Query Range Percent Splice Strand
CG11635-RA 1..861 70..930 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:24:16 Download gff for LP02810.complete
Subject Subject Range Query Range Percent Splice Strand
CG11635-RA 1..861 70..930 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:16:38 Download gff for LP02810.complete
Subject Subject Range Query Range Percent Splice Strand
CG11635-RA 1..861 70..930 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:08:30 Download gff for LP02810.complete
Subject Subject Range Query Range Percent Splice Strand
CG11635-RA 1..861 70..930 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:17:27 Download gff for LP02810.complete
Subject Subject Range Query Range Percent Splice Strand
CG11635-RA 1..861 70..930 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:26:15 Download gff for LP02810.complete
Subject Subject Range Query Range Percent Splice Strand
CG11635-RA 413..1342 1..930 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:24:16 Download gff for LP02810.complete
Subject Subject Range Query Range Percent Splice Strand
CG11635-RA 1..935 1..935 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:16:38 Download gff for LP02810.complete
Subject Subject Range Query Range Percent Splice Strand
CG11635-RA 1..935 1..935 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:08:30 Download gff for LP02810.complete
Subject Subject Range Query Range Percent Splice Strand
CG11635-RA 413..1342 1..930 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:17:27 Download gff for LP02810.complete
Subject Subject Range Query Range Percent Splice Strand
CG11635-RA 1..935 1..935 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:47 Download gff for LP02810.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8358538..8359472 1..935 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:47 Download gff for LP02810.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8358538..8359472 1..935 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:47 Download gff for LP02810.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8358538..8359472 1..935 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:16:38 Download gff for LP02810.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4246043..4246977 1..935 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:44:44 Download gff for LP02810.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8359737..8360671 1..935 100   Plus

LP02810.pep Sequence

Translation from 69 to 929

> LP02810.pep
MFWSSLLRGFSSRQSGSSNKPPKPPSPPKPPSSPSPPKSPSAKRECKIRT
HCIPAAFCAEGDKFKSMWDPPKNLPPPYPFVVSRSNDLCCEPNCTKPLPS
FDELYYRPSCKNGPYQRHWVECPKFMIRKKIICAYDKLEALSPARRVAER
RERTTLSATATGPCPHFAPLARCVPGRRPPRCHAAKTPSCCRRLCAPMPC
WSDCKQPKLAKRPYRPRECECRFPLSLCEAERGRQWVKIHGENHVCPSAI
KKAKKARKDMLKKMKKDKKDKGTDKKKDKNKDKNKK*

LP02810.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:07:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12351-PA 301 GF12351-PA 1..255 1..252 763 60.4 Plus
Dana\GF19809-PA 280 GF19809-PA 96..280 60..245 190 31.8 Plus
Dana\GF12596-PA 309 GF12596-PA 108..293 62..241 161 30 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:07:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23351-PA 288 GG23351-PA 1..268 1..265 1062 90.3 Plus
Dere\GG10654-PA 291 GG10654-PA 53..271 23..232 158 33.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:07:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20816-PA 242 GH20816-PA 58..222 72..232 147 32.4 Plus
Dgri\GH19654-PA 242 GH19654-PA 58..222 72..232 147 32.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG11635-PA 286 CG11635-PA 1..286 1..286 1619 100 Plus
hubl-PB 291 CG30364-PB 53..279 23..244 220 32.9 Plus
hubl-PA 291 CG30364-PA 53..279 23..244 220 32.9 Plus
swif-PB 284 CG30366-PB 88..279 41..235 219 33.6 Plus
swif-PA 284 CG30366-PA 88..279 41..235 219 33.6 Plus
CG2127-PB 289 CG2127-PB 34..267 4..229 204 31.2 Plus
CG2127-PA 305 CG2127-PA 50..283 4..229 204 31.2 Plus
cola-PA 259 CG30363-PA 88..226 92..229 165 31.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:07:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20909-PA 248 GI20909-PA 69..228 77..232 195 36.7 Plus
Dmoj\GI18687-PA 297 GI18687-PA 100..279 60..233 164 31.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:07:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21026-PA 288 GM21026-PA 1..262 1..262 1057 95 Plus
Dsec\GM20697-PA 285 GM20697-PA 105..279 60..235 171 34 Plus
Dsec\GM20699-PA 291 GM20699-PA 53..279 23..244 156 32.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:07:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15373-PA 288 GD15373-PA 1..262 1..262 1064 95.4 Plus
Dsim\GD15280-PA 285 GD15280-PA 105..279 60..235 171 34 Plus
Dsim\GD15283-PA 291 GD15283-PA 53..279 23..244 155 32.9 Plus
Dsim\GD15282-PA 291 GD15282-PA 53..279 23..244 154 32.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:07:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20639-PA 249 GJ20639-PA 40..238 52..241 178 33.5 Plus
Dvir\GJ20648-PA 301 GJ20648-PA 17..292 2..243 159 31.3 Plus
Dvir\GJ21704-PA 303 GJ21704-PA 102..284 55..232 154 31.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15824-PA 256 GK15824-PA 36..256 42..254 518 49.3 Plus
Dwil\GK19093-PA 213 GK19093-PA 37..199 64..230 195 36.9 Plus
Dwil\GK15752-PA 216 GK15752-PA 20..207 46..241 169 31.5 Plus
Dwil\GK15761-PA 301 GK15761-PA 109..291 64..241 162 31.4 Plus
Dwil\GK15759-PA 265 GK15759-PA 99..252 98..250 148 30.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19191-PA 290 GE19191-PA 1..260 1..260 1055 92.7 Plus
Dyak\GE23134-PA 291 GE23134-PA 53..280 29..241 158 31.8 Plus
Dyak\GE23064-PA 307 GE23064-PA 138..304 91..246 154 34.1 Plus
Dyak\GE23113-PA 284 GE23113-PA 109..263 64..221 147 34.5 Plus

LP02810.hyp Sequence

Translation from 69 to 929

> LP02810.hyp
MFWSSLLRGFSSRQSGSSNKPPKPPSPPKPPSSPSPPKSPSAKRECKIRT
HCIPAAFCAEGDKFKSMWDPPKNLPPPYPFVVSRSNDLCCEPNCTKPLPS
FDELYYRPSCKNGPYQRHWVECPKFMIRKKIICAYDKLEALSPARRVAER
RERTTLSATATGPCPHFAPLARCVPGRRPPRCHAAKTPSCCRRLCAPMPC
WSDCKQPKLAKRPYRPRECECRFPLSLCEAERGRQWVKIHGENHVCPSAI
KKAKKARKDMLKKMKKDKKDKGTDKKKDKNKDKNKK*

LP02810.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG11635-PA 286 CG11635-PA 1..286 1..286 1619 100 Plus
hubl-PB 291 CG30364-PB 53..279 23..244 220 32.9 Plus
hubl-PA 291 CG30364-PA 53..279 23..244 220 32.9 Plus
swif-PB 284 CG30366-PB 88..279 41..235 219 33.6 Plus
swif-PA 284 CG30366-PA 88..279 41..235 219 33.6 Plus