Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
LP02810.complete Sequence
952 bp (952 high quality bases) assembled on 2004-12-02
GenBank Submission: BT021373
> LP02810.complete
CGATTCATGTAACGGCGTTACGGTATACAAAAATTTTCAAAATTCCACTT
TCATTAAAAGTTTCGGCTAATGTTTTGGTCCTCCCTACTAAGGGGCTTCA
GCTCACGTCAGAGCGGCTCCTCGAATAAACCCCCAAAACCTCCAAGTCCA
CCGAAGCCACCATCGTCACCATCTCCACCAAAGTCTCCTTCTGCCAAACG
AGAATGCAAGATCCGGACGCACTGCATTCCGGCCGCCTTCTGCGCCGAAG
GGGATAAGTTCAAGTCGATGTGGGATCCGCCGAAGAACCTGCCTCCGCCG
TACCCCTTCGTGGTCAGCCGATCAAATGACTTGTGCTGCGAACCCAACTG
CACCAAACCACTGCCCTCATTCGACGAGCTGTATTACCGTCCCTCCTGCA
AGAACGGTCCTTACCAGCGCCACTGGGTGGAGTGCCCCAAGTTCATGATC
CGCAAGAAGATAATCTGCGCCTACGACAAGCTGGAGGCTCTGAGCCCCGC
CCGTCGGGTGGCCGAGCGGCGCGAGCGGACAACGCTCAGTGCCACAGCCA
CAGGACCATGTCCCCATTTCGCTCCGTTGGCACGATGCGTGCCAGGACGT
CGTCCGCCCAGATGCCACGCGGCCAAGACGCCCTCCTGCTGCCGCAGGTT
GTGTGCACCGATGCCCTGCTGGTCGGATTGTAAGCAGCCTAAGCTGGCCA
AGCGACCATATCGACCTCGCGAGTGCGAGTGCCGATTCCCCCTGAGCCTC
TGCGAAGCGGAGCGGGGTCGTCAGTGGGTCAAAATTCATGGTGAGAACCA
CGTCTGTCCCAGTGCCATAAAAAAGGCCAAGAAGGCGAGAAAAGACATGC
TCAAGAAGATGAAAAAGGATAAGAAGGATAAGGGCACGGATAAGAAGAAA
GATAAGAACAAGGATAAAAATAAAAAATAAGTTTTAAAAAAAAAAAAAAA
AA
LP02810.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:52:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11635-RA | 1342 | CG11635-RA | 413..1342 | 1..930 | 4650 | 100 | Plus |
spaw-RA | 2243 | spaw-RA | 1716..2243 | 938..411 | 2640 | 100 | Minus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:11:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 4246061..4246995 | 1..935 | 4630 | 99.7 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:47:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:10:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8358538..8359475 | 1..938 | 4690 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:41:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 8359737..8360674 | 1..938 | 4690 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 06:11:00 has no hits.
LP02810.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:11:47 Download gff for
LP02810.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 4246061..4246912 | 1..852 | 99 | == | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:34:15 Download gff for
LP02810.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11635-RA | 1..861 | 70..930 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:24:16 Download gff for
LP02810.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11635-RA | 1..861 | 70..930 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:16:38 Download gff for
LP02810.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11635-RA | 1..861 | 70..930 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:08:30 Download gff for
LP02810.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11635-RA | 1..861 | 70..930 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:17:27 Download gff for
LP02810.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11635-RA | 1..861 | 70..930 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:26:15 Download gff for
LP02810.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11635-RA | 413..1342 | 1..930 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:24:16 Download gff for
LP02810.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11635-RA | 1..935 | 1..935 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:16:38 Download gff for
LP02810.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11635-RA | 1..935 | 1..935 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:08:30 Download gff for
LP02810.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11635-RA | 413..1342 | 1..930 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:17:27 Download gff for
LP02810.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11635-RA | 1..935 | 1..935 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:47 Download gff for
LP02810.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8358538..8359472 | 1..935 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:47 Download gff for
LP02810.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8358538..8359472 | 1..935 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:47 Download gff for
LP02810.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8358538..8359472 | 1..935 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:16:38 Download gff for
LP02810.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4246043..4246977 | 1..935 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:44:44 Download gff for
LP02810.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8359737..8360671 | 1..935 | 100 | | Plus |
LP02810.pep Sequence
Translation from 69 to 929
> LP02810.pep
MFWSSLLRGFSSRQSGSSNKPPKPPSPPKPPSSPSPPKSPSAKRECKIRT
HCIPAAFCAEGDKFKSMWDPPKNLPPPYPFVVSRSNDLCCEPNCTKPLPS
FDELYYRPSCKNGPYQRHWVECPKFMIRKKIICAYDKLEALSPARRVAER
RERTTLSATATGPCPHFAPLARCVPGRRPPRCHAAKTPSCCRRLCAPMPC
WSDCKQPKLAKRPYRPRECECRFPLSLCEAERGRQWVKIHGENHVCPSAI
KKAKKARKDMLKKMKKDKKDKGTDKKKDKNKDKNKK*
LP02810.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:07:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF12351-PA | 301 | GF12351-PA | 1..255 | 1..252 | 763 | 60.4 | Plus |
Dana\GF19809-PA | 280 | GF19809-PA | 96..280 | 60..245 | 190 | 31.8 | Plus |
Dana\GF12596-PA | 309 | GF12596-PA | 108..293 | 62..241 | 161 | 30 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:07:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG23351-PA | 288 | GG23351-PA | 1..268 | 1..265 | 1062 | 90.3 | Plus |
Dere\GG10654-PA | 291 | GG10654-PA | 53..271 | 23..232 | 158 | 33.5 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:07:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH20816-PA | 242 | GH20816-PA | 58..222 | 72..232 | 147 | 32.4 | Plus |
Dgri\GH19654-PA | 242 | GH19654-PA | 58..222 | 72..232 | 147 | 32.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11635-PA | 286 | CG11635-PA | 1..286 | 1..286 | 1619 | 100 | Plus |
hubl-PB | 291 | CG30364-PB | 53..279 | 23..244 | 220 | 32.9 | Plus |
hubl-PA | 291 | CG30364-PA | 53..279 | 23..244 | 220 | 32.9 | Plus |
swif-PB | 284 | CG30366-PB | 88..279 | 41..235 | 219 | 33.6 | Plus |
swif-PA | 284 | CG30366-PA | 88..279 | 41..235 | 219 | 33.6 | Plus |
CG2127-PB | 289 | CG2127-PB | 34..267 | 4..229 | 204 | 31.2 | Plus |
CG2127-PA | 305 | CG2127-PA | 50..283 | 4..229 | 204 | 31.2 | Plus |
cola-PA | 259 | CG30363-PA | 88..226 | 92..229 | 165 | 31.8 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:07:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI20909-PA | 248 | GI20909-PA | 69..228 | 77..232 | 195 | 36.7 | Plus |
Dmoj\GI18687-PA | 297 | GI18687-PA | 100..279 | 60..233 | 164 | 31.9 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:07:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM21026-PA | 288 | GM21026-PA | 1..262 | 1..262 | 1057 | 95 | Plus |
Dsec\GM20697-PA | 285 | GM20697-PA | 105..279 | 60..235 | 171 | 34 | Plus |
Dsec\GM20699-PA | 291 | GM20699-PA | 53..279 | 23..244 | 156 | 32.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:07:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD15373-PA | 288 | GD15373-PA | 1..262 | 1..262 | 1064 | 95.4 | Plus |
Dsim\GD15280-PA | 285 | GD15280-PA | 105..279 | 60..235 | 171 | 34 | Plus |
Dsim\GD15283-PA | 291 | GD15283-PA | 53..279 | 23..244 | 155 | 32.9 | Plus |
Dsim\GD15282-PA | 291 | GD15282-PA | 53..279 | 23..244 | 154 | 32.9 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:07:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ20639-PA | 249 | GJ20639-PA | 40..238 | 52..241 | 178 | 33.5 | Plus |
Dvir\GJ20648-PA | 301 | GJ20648-PA | 17..292 | 2..243 | 159 | 31.3 | Plus |
Dvir\GJ21704-PA | 303 | GJ21704-PA | 102..284 | 55..232 | 154 | 31.5 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:07:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK15824-PA | 256 | GK15824-PA | 36..256 | 42..254 | 518 | 49.3 | Plus |
Dwil\GK19093-PA | 213 | GK19093-PA | 37..199 | 64..230 | 195 | 36.9 | Plus |
Dwil\GK15752-PA | 216 | GK15752-PA | 20..207 | 46..241 | 169 | 31.5 | Plus |
Dwil\GK15761-PA | 301 | GK15761-PA | 109..291 | 64..241 | 162 | 31.4 | Plus |
Dwil\GK15759-PA | 265 | GK15759-PA | 99..252 | 98..250 | 148 | 30.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:07:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE19191-PA | 290 | GE19191-PA | 1..260 | 1..260 | 1055 | 92.7 | Plus |
Dyak\GE23134-PA | 291 | GE23134-PA | 53..280 | 29..241 | 158 | 31.8 | Plus |
Dyak\GE23064-PA | 307 | GE23064-PA | 138..304 | 91..246 | 154 | 34.1 | Plus |
Dyak\GE23113-PA | 284 | GE23113-PA | 109..263 | 64..221 | 147 | 34.5 | Plus |
LP02810.hyp Sequence
Translation from 69 to 929
> LP02810.hyp
MFWSSLLRGFSSRQSGSSNKPPKPPSPPKPPSSPSPPKSPSAKRECKIRT
HCIPAAFCAEGDKFKSMWDPPKNLPPPYPFVVSRSNDLCCEPNCTKPLPS
FDELYYRPSCKNGPYQRHWVECPKFMIRKKIICAYDKLEALSPARRVAER
RERTTLSATATGPCPHFAPLARCVPGRRPPRCHAAKTPSCCRRLCAPMPC
WSDCKQPKLAKRPYRPRECECRFPLSLCEAERGRQWVKIHGENHVCPSAI
KKAKKARKDMLKKMKKDKKDKGTDKKKDKNKDKNKK*
LP02810.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:48:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11635-PA | 286 | CG11635-PA | 1..286 | 1..286 | 1619 | 100 | Plus |
hubl-PB | 291 | CG30364-PB | 53..279 | 23..244 | 220 | 32.9 | Plus |
hubl-PA | 291 | CG30364-PA | 53..279 | 23..244 | 220 | 32.9 | Plus |
swif-PB | 284 | CG30366-PB | 88..279 | 41..235 | 219 | 33.6 | Plus |
swif-PA | 284 | CG30366-PA | 88..279 | 41..235 | 219 | 33.6 | Plus |