Clone LP02874 Report

Search the DGRC for LP02874

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:28
Well:74
Vector:pOT2
Associated Gene/TranscriptCG3625-RA
Protein status:LP02874.pep: gold
Sequenced Size:993

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3625-RA 2009-06-22 Replacement based on scoring

Clone Sequence Records

LP02874.complete Sequence

993 bp assembled on 2009-08-07

GenBank Submission: BT099514.1

> LP02874.complete
GCACCAGGAGATTCAACATGGCCAAGCCCAAGTCAAAATCGACTAGCAAA
GGTTCCACTTCGCCGGGTTTTAACAAGGCGGTGCAGTTGCTCCTCCATTT
TACAGCCGTGCTGCAGTTCAACTATGGCGTGTACATCTTCCACACACTCG
ACATGCCCAACACGGTGCCCTTCGGCGGAAAATTTAAGTTCCTAACTTTT
ATTTGTGCGATAATTCAGGCACTGTACTATATTGTATCGCTGGTCAACGA
TTTCGTGGGCACTAATGAGCTGACACCCAAGAAACCTCCGGCGGTTCGCA
GGTTCAAGGACTGGCTGATGGCTACATTGGCCTTTCCAGTGGCTATCAAT
GTGGGCGTGACCTTCTGGACACTGTACGCTATCGACAGGGAGCTAGTCTT
CCCCAAGGTTCTGGACCCCGTGTTCCCCAGCTGGCTCAACCACGTCCTGC
ACACCAACATAGTGGTTTTCATCATCCTGGAGCTGTTCATCTCGTACAGG
TCGTACCCAAAACGAAGCCAAGGACTCGCAGGACTGGCCATTTTCATGGG
CGCCTACCTGGTTTGGATTCACGTGGTGAAGCACTACTCGGGTGTGTGGG
TGTATCCAGTGCTCGAGGTTCTCCAGCTTCCGCAACGCATCCTGTTTTTT
GCGGCCGTCGTTGGATTCACGCTGTCACTTTACCTGCTGGGCGAGTTCCT
CAACAATACCGTCTGGGCCAAGGAAGTGAAGTTGGCCAAGCGCAAATCCA
ACTAGGAGGCTGTGACCCGTTTCTGTTCGATGTAGTTGCGTTAATTAGCC
ACAAAATACAAATAGTGATTGACAGGTCTCGATTATACATTTTGCTCATA
TTGTTCGATCTTCTCAGCCAAAGAAATTTTTCATAAGTATGTAAAATCGT
ACTGCAAAGTTAACTGAAGAAGGCGTACAAAATATGTGAGAAATAATAAA
CGAAACTTGAAACATCAACTCGATAATATAAAAAAAAAAAAAA

LP02874.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG3625-RA 1425 CG3625-RA 141..1120 1..980 4900 100 Plus
CG3625.c 1967 CG3625.c 683..1662 1..980 4900 100 Plus
CG3625-RB 1549 CG3625-RB 470..1244 206..980 3875 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 283694..284249 979..428 2655 98.9 Minus
chr2L 23010047 chr2L 284784..285005 430..209 1095 99.5 Minus
chr2L 23010047 chr2L 286339..286551 213..1 1050 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:47:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 283661..284213 980..428 2765 100 Minus
2L 23513712 2L 284748..284969 430..209 1110 100 Minus
2L 23513712 2L 286303..286515 213..1 1050 99.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:25:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 283661..284213 980..428 2765 100 Minus
2L 23513712 2L 284748..284969 430..209 1110 100 Minus
2L 23513712 2L 286303..286515 213..1 1050 99.5 Minus
Blast to na_te.dros performed on 2019-03-16 21:49:21 has no hits.

LP02874.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:50:28 Download gff for LP02874.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 283694..284246 431..979 98 <- Minus
chr2L 284784..285004 210..430 99 <- Minus
chr2L 286343..286551 1..209 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:13:09 Download gff for LP02874.complete
Subject Subject Range Query Range Percent Splice Strand
CG3625-RA 1..738 18..755 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:57:05 Download gff for LP02874.complete
Subject Subject Range Query Range Percent Splice Strand
CG3625-RA 1..738 18..755 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:03:34 Download gff for LP02874.complete
Subject Subject Range Query Range Percent Splice Strand
CG3625-RA 1..738 18..755 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:32:26 Download gff for LP02874.complete
Subject Subject Range Query Range Percent Splice Strand
CG3625-RA 1..738 18..755 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-07 08:53:06 Download gff for LP02874.complete
Subject Subject Range Query Range Percent Splice Strand
CG3625-RA 13..991 1..979 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:57:05 Download gff for LP02874.complete
Subject Subject Range Query Range Percent Splice Strand
CG3625-RA 13..991 1..979 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:03:34 Download gff for LP02874.complete
Subject Subject Range Query Range Percent Splice Strand
CG3625-RA 17..995 1..979 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:32:26 Download gff for LP02874.complete
Subject Subject Range Query Range Percent Splice Strand
CG3625-RA 17..995 1..979 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:50:28 Download gff for LP02874.complete
Subject Subject Range Query Range Percent Splice Strand
2L 283662..284210 431..979 100 <- Minus
2L 284748..284968 210..430 100 <- Minus
2L 286307..286515 1..209 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:50:28 Download gff for LP02874.complete
Subject Subject Range Query Range Percent Splice Strand
2L 283662..284210 431..979 100 <- Minus
2L 284748..284968 210..430 100 <- Minus
2L 286307..286515 1..209 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:50:28 Download gff for LP02874.complete
Subject Subject Range Query Range Percent Splice Strand
2L 283662..284210 431..979 100 <- Minus
2L 284748..284968 210..430 100 <- Minus
2L 286307..286515 1..209 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:03:34 Download gff for LP02874.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 283662..284210 431..979 100 <- Minus
arm_2L 284748..284968 210..430 100 <- Minus
arm_2L 286307..286515 1..209 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:48:38 Download gff for LP02874.complete
Subject Subject Range Query Range Percent Splice Strand
2L 283662..284210 431..979 100 <- Minus
2L 284748..284968 210..430 100 <- Minus
2L 286307..286515 1..209 100   Minus

LP02874.hyp Sequence

Translation from 2 to 754

> LP02874.hyp
TRRFNMAKPKSKSTSKGSTSPGFNKAVQLLLHFTAVLQFNYGVYIFHTLD
MPNTVPFGGKFKFLTFICAIIQALYYIVSLVNDFVGTNELTPKKPPAVRR
FKDWLMATLAFPVAINVGVTFWTLYAIDRELVFPKVLDPVFPSWLNHVLH
TNIVVFIILELFISYRSYPKRSQGLAGLAIFMGAYLVWIHVVKHYSGVWV
YPVLEVLQLPQRILFFAAVVGFTLSLYLLGEFLNNTVWAKEVKLAKRKSN
*

LP02874.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG3625-PA 245 CG3625-PA 1..245 6..250 1280 100 Plus
CG3625-PB 248 CG3625-PB 3..248 13..250 1049 84.1 Plus
CG3625-PE 247 CG3625-PE 15..247 30..250 967 82.1 Plus
CG3625-PC 247 CG3625-PC 15..247 30..250 967 82.1 Plus
CG11601-PC 275 CG11601-PC 9..270 2..248 578 42 Plus

LP02874.pep Sequence

Translation from 2 to 754

> LP02874.pep
TRRFNMAKPKSKSTSKGSTSPGFNKAVQLLLHFTAVLQFNYGVYIFHTLD
MPNTVPFGGKFKFLTFICAIIQALYYIVSLVNDFVGTNELTPKKPPAVRR
FKDWLMATLAFPVAINVGVTFWTLYAIDRELVFPKVLDPVFPSWLNHVLH
TNIVVFIILELFISYRSYPKRSQGLAGLAIFMGAYLVWIHVVKHYSGVWV
YPVLEVLQLPQRILFFAAVVGFTLSLYLLGEFLNNTVWAKEVKLAKRKSN
*

LP02874.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:40:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24926-PA 250 GF24926-PA 1..250 6..250 1017 79.6 Plus
Dana\GF24937-PA 275 GF24937-PA 9..271 2..249 576 42.6 Plus
Dana\GF24553-PA 310 GF24553-PA 8..227 22..241 470 39 Plus
Dana\GF24915-PA 67 GF24915-PA 1..64 6..69 280 82.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:40:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24663-PA 248 GG24663-PA 3..248 13..250 1028 82.5 Plus
Dere\GG24665-PA 275 GG24665-PA 9..270 2..248 572 43 Plus
Dere\GG13922-PA 236 GG13922-PA 11..233 28..250 443 38.1 Plus
Dere\GG24662-PA 67 GG24662-PA 1..65 6..70 333 95.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:40:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10220-PA 252 GH10220-PA 18..252 26..250 910 71.9 Plus
Dgri\GH11507-PA 277 GH11507-PA 14..273 1..249 522 42.1 Plus
Dgri\GH23361-PA 129 GH23361-PA 44..129 58..151 206 37.2 Plus
Dgri\GH14847-PA 129 GH14847-PA 25..129 41..151 205 35.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG3625-PA 245 CG3625-PA 1..245 6..250 1280 100 Plus
CG3625-PB 248 CG3625-PB 3..248 13..250 1049 84.1 Plus
CG3625-PE 247 CG3625-PE 15..247 30..250 967 82.1 Plus
CG3625-PC 247 CG3625-PC 15..247 30..250 967 82.1 Plus
CG11601-PC 275 CG11601-PC 9..270 2..248 578 42 Plus
CG11601-PB 275 CG11601-PB 9..270 2..248 578 42 Plus
CG11601-PA 275 CG11601-PA 9..270 2..248 578 42 Plus
CG6149-PB 234 CG6149-PB 11..223 28..240 471 39.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:40:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15038-PA 252 GI15038-PA 2..252 13..250 933 71.3 Plus
Dmoj\GI17003-PA 275 GI17003-PA 15..270 2..248 583 41.8 Plus
Dmoj\GI13700-PA 223 GI13700-PA 5..218 28..241 304 34.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:40:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25826-PA 249 GL25826-PA 4..249 13..250 987 76.4 Plus
Dper\GL25827-PA 114 GL25827-PA 3..99 143..239 277 50.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:40:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17568-PA 249 GA17568-PA 4..249 13..250 990 76.8 Plus
Dpse\GA11092-PA 277 GA11092-PA 8..260 1..239 559 42.5 Plus
Dpse\GA19393-PA 239 GA19393-PA 14..234 28..248 465 39.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:40:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16682-PA 245 GM16682-PA 1..245 6..250 1271 99.2 Plus
Dsec\GM16683-PA 275 GM16683-PA 9..270 2..248 572 42.6 Plus
Dsec\GM13272-PA 141 GM13272-PA 3..140 13..142 480 71 Plus
Dsec\GM24755-PA 296 GM24755-PA 67..293 24..250 436 37.9 Plus
Dsec\GM13271-PA 71 GM13271-PA 16..67 21..72 259 92.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:40:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22970-PA 245 GD22970-PA 1..245 6..250 1271 99.2 Plus
Dsim\GD22971-PA 275 GD22971-PA 9..270 2..248 573 43 Plus
Dsim\GD12806-PA 296 GD12806-PA 67..293 24..250 465 37.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:40:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17242-PA 251 GJ17242-PA 3..251 15..250 929 71.1 Plus
Dvir\GJ24281-PA 275 GJ24281-PA 19..271 5..249 587 43.1 Plus
Dvir\GJ14040-PA 228 GJ14040-PA 13..224 27..238 450 38.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:40:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14825-PA 257 GK14825-PA 7..257 13..250 985 75.3 Plus
Dwil\GK14826-PA 275 GK14826-PA 20..271 7..249 562 42.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:40:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16272-PA 248 GE16272-PA 3..248 13..250 1032 82.5 Plus
Dyak\GE16283-PA 275 GE16283-PA 9..270 2..248 561 42.2 Plus
Dyak\GE20218-PA 229 GE20218-PA 11..217 28..234 398 39.1 Plus
Dyak\GE16261-PA 104 GE16261-PA 21..97 1..75 257 75.3 Plus