LP02994.complete Sequence
281 bp (281 high quality bases) assembled on 2002-05-18
GenBank Submission: AY119002
> LP02994.complete
TCAACATGAAATTCTTCAACCTGCTGTTTAGCCTCTGTCTGGCCTTCATG
CTGTGCACCTCGTGGGTGTCGGCTTTCTCCAGTCTTGCCACCCCGGAGCC
AACTCCGCCAACTGGTGCTCCCGTCGATGGTACGACTAGCACGGGATTCT
CTGGTCCGCCGCAGGCTGAGACCACAAATGCCACGCCAGAAACGTCGACC
ATCTATCCCATTTACGGATAGTCATCATCGATTGATGAATTAAAAACTGA
ATCGCAAATATAAAAAAAAAAAAAAAAAAAA
LP02994.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:02:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14302-RA | 401 | CG14302-RA | 141..401 | 1..261 | 1305 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:46:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 14556890..14557138 | 13..261 | 1245 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:47:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:45:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 18732786..18733035 | 13..262 | 1250 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:34:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 18473617..18473866 | 13..262 | 1250 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 18:45:59 has no hits.
LP02994.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:46:38 Download gff for
LP02994.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 14556890..14557138 | 13..261 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:34:31 Download gff for
LP02994.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-RA | 1..216 | 6..221 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:43:26 Download gff for
LP02994.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-RA | 1..216 | 6..221 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:26:16 Download gff for
LP02994.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-RA | 1..216 | 6..221 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:35:33 Download gff for
LP02994.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-RA | 1..216 | 6..221 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:50:08 Download gff for
LP02994.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-RA | 1..216 | 6..221 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:17:58 Download gff for
LP02994.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-RA | 1..261 | 1..261 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:43:26 Download gff for
LP02994.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-RA | 1..261 | 1..261 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:26:16 Download gff for
LP02994.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-RA | 1..261 | 1..261 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:35:34 Download gff for
LP02994.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-RA | 1..261 | 1..261 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:50:08 Download gff for
LP02994.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-RA | 21..281 | 1..261 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:46:38 Download gff for
LP02994.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18732786..18733034 | 13..261 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:46:38 Download gff for
LP02994.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18732786..18733034 | 13..261 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:46:38 Download gff for
LP02994.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18732786..18733034 | 13..261 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:26:16 Download gff for
LP02994.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 14558508..14558756 | 13..261 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:07:57 Download gff for
LP02994.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18473617..18473865 | 13..261 | 100 | | Plus |
LP02994.hyp Sequence
Translation from 2 to 220
> LP02994.hyp
NMKFFNLLFSLCLAFMLCTSWVSAFSSLATPEPTPPTGAPVDGTTSTGFS
GPPQAETTNATPETSTIYPIYG*
LP02994.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:08:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14302-PA | 71 | CG14302-PA | 1..71 | 2..72 | 381 | 100 | Plus |
LP02994.pep Sequence
Translation from 5 to 220
> LP02994.pep
MKFFNLLFSLCLAFMLCTSWVSAFSSLATPEPTPPTGAPVDGTTSTGFSG
PPQAETTNATPETSTIYPIYG*
LP02994.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:54:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF17124-PA | 71 | GF17124-PA | 1..71 | 1..70 | 184 | 56.9 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:54:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG23060-PA | 71 | GG23060-PA | 1..71 | 1..71 | 312 | 87.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14302-PA | 71 | CG14302-PA | 1..71 | 1..71 | 381 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:54:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL24431-PA | 70 | GL24431-PA | 1..70 | 1..70 | 193 | 61.1 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:54:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA12891-PA | 70 | GA12891-PA | 1..70 | 1..70 | 175 | 54.2 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:54:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM17888-PA | 71 | GM17888-PA | 1..71 | 1..71 | 348 | 98.6 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:54:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD19247-PA | 71 | GD19247-PA | 1..71 | 1..71 | 345 | 95.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:54:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE25558-PA | 71 | GE25558-PA | 1..71 | 1..71 | 313 | 87.3 | Plus |