Clone LP02994 Report

Search the DGRC for LP02994

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:29
Well:94
Vector:pOT2
Associated Gene/TranscriptCG14302-RA
Protein status:LP02994.pep: gold
Preliminary Size:268
Sequenced Size:281

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14302 2002-01-01 Sim4 clustering to Release 2
CG14302 2002-05-18 Blastp of sequenced clone
CG14302 2003-01-01 Sim4 clustering to Release 3
CG14302 2008-04-29 Release 5.5 accounting
CG14302 2008-08-15 Release 5.9 accounting
CG14302 2008-12-18 5.12 accounting

Clone Sequence Records

LP02994.complete Sequence

281 bp (281 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119002

> LP02994.complete
TCAACATGAAATTCTTCAACCTGCTGTTTAGCCTCTGTCTGGCCTTCATG
CTGTGCACCTCGTGGGTGTCGGCTTTCTCCAGTCTTGCCACCCCGGAGCC
AACTCCGCCAACTGGTGCTCCCGTCGATGGTACGACTAGCACGGGATTCT
CTGGTCCGCCGCAGGCTGAGACCACAAATGCCACGCCAGAAACGTCGACC
ATCTATCCCATTTACGGATAGTCATCATCGATTGATGAATTAAAAACTGA
ATCGCAAATATAAAAAAAAAAAAAAAAAAAA

LP02994.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:02:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG14302-RA 401 CG14302-RA 141..401 1..261 1305 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14556890..14557138 13..261 1245 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:47:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:45:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18732786..18733035 13..262 1250 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:34:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18473617..18473866 13..262 1250 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:45:59 has no hits.

LP02994.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:46:38 Download gff for LP02994.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14556890..14557138 13..261 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:34:31 Download gff for LP02994.complete
Subject Subject Range Query Range Percent Splice Strand
CG14302-RA 1..216 6..221 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:43:26 Download gff for LP02994.complete
Subject Subject Range Query Range Percent Splice Strand
CG14302-RA 1..216 6..221 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:26:16 Download gff for LP02994.complete
Subject Subject Range Query Range Percent Splice Strand
CG14302-RA 1..216 6..221 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:35:33 Download gff for LP02994.complete
Subject Subject Range Query Range Percent Splice Strand
CG14302-RA 1..216 6..221 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:50:08 Download gff for LP02994.complete
Subject Subject Range Query Range Percent Splice Strand
CG14302-RA 1..216 6..221 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:17:58 Download gff for LP02994.complete
Subject Subject Range Query Range Percent Splice Strand
CG14302-RA 1..261 1..261 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:43:26 Download gff for LP02994.complete
Subject Subject Range Query Range Percent Splice Strand
CG14302-RA 1..261 1..261 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:26:16 Download gff for LP02994.complete
Subject Subject Range Query Range Percent Splice Strand
CG14302-RA 1..261 1..261 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:35:34 Download gff for LP02994.complete
Subject Subject Range Query Range Percent Splice Strand
CG14302-RA 1..261 1..261 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:50:08 Download gff for LP02994.complete
Subject Subject Range Query Range Percent Splice Strand
CG14302-RA 21..281 1..261 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:46:38 Download gff for LP02994.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18732786..18733034 13..261 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:46:38 Download gff for LP02994.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18732786..18733034 13..261 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:46:38 Download gff for LP02994.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18732786..18733034 13..261 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:26:16 Download gff for LP02994.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14558508..14558756 13..261 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:07:57 Download gff for LP02994.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18473617..18473865 13..261 100   Plus

LP02994.hyp Sequence

Translation from 2 to 220

> LP02994.hyp
NMKFFNLLFSLCLAFMLCTSWVSAFSSLATPEPTPPTGAPVDGTTSTGFS
GPPQAETTNATPETSTIYPIYG*

LP02994.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG14302-PA 71 CG14302-PA 1..71 2..72 381 100 Plus

LP02994.pep Sequence

Translation from 5 to 220

> LP02994.pep
MKFFNLLFSLCLAFMLCTSWVSAFSSLATPEPTPPTGAPVDGTTSTGFSG
PPQAETTNATPETSTIYPIYG*

LP02994.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17124-PA 71 GF17124-PA 1..71 1..70 184 56.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23060-PA 71 GG23060-PA 1..71 1..71 312 87.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG14302-PA 71 CG14302-PA 1..71 1..71 381 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24431-PA 70 GL24431-PA 1..70 1..70 193 61.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12891-PA 70 GA12891-PA 1..70 1..70 175 54.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17888-PA 71 GM17888-PA 1..71 1..71 348 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19247-PA 71 GD19247-PA 1..71 1..71 345 95.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:54:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25558-PA 71 GE25558-PA 1..71 1..71 313 87.3 Plus