Clone LP03067 Report

Search the DGRC for LP03067

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:30
Well:67
Vector:pOT2
Associated Gene/TranscriptCG7924-RA
Protein status:LP03067.pep: gold
Preliminary Size:1209
Sequenced Size:1099

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7924 2001-01-01 Release 2 assignment
CG7924 2001-11-29 Blastp of sequenced clone
CG7924 2003-01-01 Sim4 clustering to Release 3
CG7924 2008-04-29 Release 5.5 accounting
CG7924 2008-08-15 Release 5.9 accounting
CG7924 2008-12-18 5.12 accounting

Clone Sequence Records

LP03067.complete Sequence

1099 bp (1099 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069725

> LP03067.complete
TGGAGTTAAAGTTACAGGATGTTTAAGCCACAATATCACTTGGCCGCAGT
GCTGCTGTGTTTCGTCTTCACCACAGCGCAGGTTGTGCCAAATGCAGAAA
TCGGTCGGATTACTATCCAAGTGCCGTTGCTGTCCAATGGAAAGCCCGTG
ATCCTGACCAACCAGGAACGGGAAGAGATCGCCACCGTGCAGGAGATCAA
GCCGGGAAAGGTCCATGTTGTCCAGGAGGTAGTGGTGCCACCTACTGTGA
AGTCTGATAATAAGGTGCGGGTGACAAGATCAGTTTCGGATTCTGGTATC
CCTAACCATGGAATCCCAAATCCTGGCATCCCTAACCATGGAATACCGAA
TCGTGGAATTCCTAATGATGGAATCCCAAATCCTGGCATTCCTAATCATG
GAATTCCAAATCCTGGAATCCCTAATCATGGAATTCCAAACCGTGGCATT
CCTAATGATGGAATCCCGAATCCTGGCATTCCCAATCACGGTATTCCCAA
CCCTGGAATCCCTAATCATGGAATTCCAAACCGCGGCATTCCTAATGATG
GAATCCCTAACCCTGGCATCCCCAACCATGGAATCCCCAATCCTGGCATA
CCCAATCCCGATGCTTCCGAACTTAAACCAGTTGTTGTAATGCCCAGCAG
TCGTACCACCAGCGCACCCGCATCTACATCAATGCCCAAGCGAGTACCCA
CCAGAAATTGTTTCCATCTTCTGATGGGTGGCACGACCACTACGTCGCCA
GTGGATATGATGACACCACCATCTATGGAAAACTGCGATGAGCTATGCAC
CAAGTTCGAGTACTCGCCCATTTGTGCCCACAATGGAATCTGCATCCATG
AGTTTGCAAATCAGTGCGTAATGAACACCTTCAACTGCAAACACCGCGAT
TTGTCGTTCCGTGCAGTGGATGAGGATGTGTGCCGACTGGGAGTTTGCAT
GAGGCGATGCAAGGAGGAGGAACTGGCGCTATAAAATGGCGATTACTCTT
AGTCATAGTGTTATATCAATACAATATAATTTGTGTAAAAACATAAAAAA
AAACATTTAATTAAATGCATACATAACATAAAAAAAAAAAAAAAAAAAA

LP03067.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG7924.a 1430 CG7924.a 153..1237 1..1085 5410 99.9 Plus
CG7924-RA 1236 CG7924-RA 153..1236 1..1084 5405 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:16:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14223677..14224710 47..1079 5045 99.4 Plus
chr3L 24539361 chr3L 14223923..14224147 383..607 720 88 Plus
chr3L 24539361 chr3L 14224013..14224237 293..517 690 87.1 Plus
chr3L 24539361 chr3L 14223923..14224205 323..605 590 80.6 Plus
chr3L 24539361 chr3L 14223953..14224235 293..575 590 80.6 Plus
chr3L 24539361 chr3L 14223924..14224176 354..606 545 81 Plus
chr3L 24539361 chr3L 14223984..14224236 294..546 545 81 Plus
chr3L 24539361 chr3L 14224043..14224237 293..487 450 82.1 Plus
chr3L 24539361 chr3L 14223923..14224117 413..607 435 81.5 Plus
chr3L 24539361 chr3L 14223924..14224086 444..606 320 79.8 Plus
chr3L 24539361 chr3L 14224074..14224236 294..456 320 79.8 Plus
chr3L 24539361 chr3L 14223923..14224057 473..607 300 81.5 Plus
chr3L 24539361 chr3L 14224103..14224237 293..427 285 80.7 Plus
chr3L 24539361 chr3L 14223569..14223617 1..49 245 100 Plus
chr3L 24539361 chr3L 14223923..14224027 503..607 210 80 Plus
chr3L 24539361 chr3L 14224133..14224237 293..397 210 80 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:47:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:16:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14233577..14234615 47..1085 5180 99.9 Plus
3L 28110227 3L 14233823..14234047 383..607 705 87.6 Plus
3L 28110227 3L 14233913..14234137 293..517 705 87.6 Plus
3L 28110227 3L 14233823..14234105 323..605 605 80.9 Plus
3L 28110227 3L 14233853..14234135 293..575 605 80.9 Plus
3L 28110227 3L 14233824..14234076 354..606 545 81 Plus
3L 28110227 3L 14233884..14234136 294..546 545 81 Plus
3L 28110227 3L 14233823..14234017 413..607 450 82.1 Plus
3L 28110227 3L 14233943..14234137 293..487 450 82.1 Plus
3L 28110227 3L 14233824..14233986 444..606 320 79.8 Plus
3L 28110227 3L 14233974..14234136 294..456 320 79.8 Plus
3L 28110227 3L 14233823..14233957 473..607 285 80.7 Plus
3L 28110227 3L 14234003..14234137 293..427 285 80.7 Plus
3L 28110227 3L 14233469..14233517 1..49 245 100 Plus
3L 28110227 3L 14233823..14233927 503..607 210 80 Plus
3L 28110227 3L 14234033..14234137 293..397 210 80 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14226677..14227715 47..1085 5180 99.9 Plus
3L 28103327 3L 14226569..14226617 1..49 245 100 Plus
Blast to na_te.dros performed 2019-03-16 12:16:45
Subject Length Description Subject Range Query Range Score Percent Strand
transib1 2167 transib1 TRANSIB1 2167bp 1859..1965 970..1078 135 59.6 Plus

LP03067.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:17:26 Download gff for LP03067.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14223569..14223617 1..49 100 -> Plus
chr3L 14223680..14224710 50..1079 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:34:36 Download gff for LP03067.complete
Subject Subject Range Query Range Percent Splice Strand
CG7924-RA 1..966 19..984 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:22:56 Download gff for LP03067.complete
Subject Subject Range Query Range Percent Splice Strand
CG7924-RA 1..966 19..984 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:07:09 Download gff for LP03067.complete
Subject Subject Range Query Range Percent Splice Strand
CG7924-RA 1..966 19..984 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:49:29 Download gff for LP03067.complete
Subject Subject Range Query Range Percent Splice Strand
CG7924-RA 1..966 19..984 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:41:38 Download gff for LP03067.complete
Subject Subject Range Query Range Percent Splice Strand
CG7924-RA 1..966 19..984 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:57:49 Download gff for LP03067.complete
Subject Subject Range Query Range Percent Splice Strand
CG7924-RA 1..1079 1..1079 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:22:56 Download gff for LP03067.complete
Subject Subject Range Query Range Percent Splice Strand
CG7924-RA 1..1079 1..1079 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:07:09 Download gff for LP03067.complete
Subject Subject Range Query Range Percent Splice Strand
CG7924-RA 1..1079 1..1079 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:49:29 Download gff for LP03067.complete
Subject Subject Range Query Range Percent Splice Strand
CG7924-RA 1..1079 1..1079 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:41:38 Download gff for LP03067.complete
Subject Subject Range Query Range Percent Splice Strand
CG7924-RA 1..1079 1..1079 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:17:26 Download gff for LP03067.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14233469..14233517 1..49 100 -> Plus
3L 14233580..14234609 50..1079 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:17:26 Download gff for LP03067.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14233469..14233517 1..49 100 -> Plus
3L 14233580..14234609 50..1079 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:17:26 Download gff for LP03067.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14233469..14233517 1..49 100 -> Plus
3L 14233580..14234609 50..1079 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:07:09 Download gff for LP03067.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14226569..14226617 1..49 100 -> Plus
arm_3L 14226680..14227709 50..1079 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:25:56 Download gff for LP03067.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14226680..14227709 50..1079 100   Plus
3L 14226569..14226617 1..49 100 -> Plus

LP03067.pep Sequence

Translation from 18 to 983

> LP03067.pep
MFKPQYHLAAVLLCFVFTTAQVVPNAEIGRITIQVPLLSNGKPVILTNQE
REEIATVQEIKPGKVHVVQEVVVPPTVKSDNKVRVTRSVSDSGIPNHGIP
NPGIPNHGIPNRGIPNDGIPNPGIPNHGIPNPGIPNHGIPNRGIPNDGIP
NPGIPNHGIPNPGIPNHGIPNRGIPNDGIPNPGIPNHGIPNPGIPNPDAS
ELKPVVVMPSSRTTSAPASTSMPKRVPTRNCFHLLMGGTTTTSPVDMMTP
PSMENCDELCTKFEYSPICAHNGICIHEFANQCVMNTFNCKHRDLSFRAV
DEDVCRLGVCMRRCKEEELAL*

LP03067.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24597-PA 301 GF24597-PA 1..299 1..319 1092 74.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15680-PA 361 GG15680-PA 1..361 1..321 1436 84.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17097-PA 333 GH17097-PA 1..333 1..321 783 50.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG7924-PA 321 CG7924-PA 1..321 1..321 1763 100 Plus
Ebp-PB 377 CG2668-PB 108..225 83..204 154 37.5 Plus
Ebp-PA 377 CG2668-PA 108..225 83..204 154 37.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11699-PA 365 GI11699-PA 1..365 1..321 838 52.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21005-PA 359 GL21005-PA 1..359 1..321 1067 65.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:46:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20692-PA 349 GA20692-PA 1..349 1..321 1083 66.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25462-PA 331 GM25462-PA 1..331 1..321 1425 91.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14487-PA 331 GD14487-PA 1..331 1..321 1416 90.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11374-PA 273 GJ11374-PA 12..273 6..321 663 49.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12686-PA 308 GK12686-PA 1..308 1..321 908 60.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22010-PA 321 GE22010-PA 1..321 1..321 1493 94.7 Plus

LP03067.hyp Sequence

Translation from 18 to 983

> LP03067.hyp
MFKPQYHLAAVLLCFVFTTAQVVPNAEIGRITIQVPLLSNGKPVILTNQE
REEIATVQEIKPGKVHVVQEVVVPPTVKSDNKVRVTRSVSDSGIPNHGIP
NPGIPNHGIPNRGIPNDGIPNPGIPNHGIPNPGIPNHGIPNRGIPNDGIP
NPGIPNHGIPNPGIPNHGIPNRGIPNDGIPNPGIPNHGIPNPGIPNPDAS
ELKPVVVMPSSRTTSAPASTSMPKRVPTRNCFHLLMGGTTTTSPVDMMTP
PSMENCDELCTKFEYSPICAHNGICIHEFANQCVMNTFNCKHRDLSFRAV
DEDVCRLGVCMRRCKEEELAL*

LP03067.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:22:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG7924-PA 321 CG7924-PA 1..321 1..321 1763 100 Plus
Peb-PB 377 CG2668-PB 108..225 83..204 154 37.5 Plus
Peb-PA 377 CG2668-PA 108..225 83..204 154 37.5 Plus