Clone LP03404 Report

Search the DGRC for LP03404

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:34
Well:4
Vector:pOT2
Associated Gene/TranscriptCG11103-RB
Protein status:LP03404.pep: gold
Preliminary Size:675
Sequenced Size:887

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11103 2002-01-01 Sim4 clustering to Release 2
CG11103 2002-05-18 Blastp of sequenced clone
CG11103 2003-01-01 Sim4 clustering to Release 3
CG11103 2008-04-29 Release 5.5 accounting
CG11103 2008-08-15 Release 5.9 accounting
CG11103 2008-12-18 5.12 accounting

Clone Sequence Records

LP03404.complete Sequence

887 bp (887 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119007

> LP03404.complete
CGGACTACTGGCGTTCCTGGTGGCCAGACAACACGATGCCCAAGCGATAC
AGGCACGCAGCGACAAGGAGCAGCCGCAGACTGTGGTCTCCGGCACGGCG
GTGCAATCGGTGGTGCCCGTTCAGGCGCAACTGGGCTCCGGCATGGGACC
CTCCTCATCGTCATCTTCGGCATCTTCCGCCTCGGGCGGAGCTGGAAACT
CGGCCTTCTATCCACTGGGACCGAATGTGATGTGCTCGTTTCTGCCGCGC
GACTTTCTCGATTGCAAGGATCCCGTCGATCATCGGGAGAACGCCACGGC
GCAGCAGGAAAAGAAATACGGATGCCTGAAGTTCGGTGGTTCCACGTACG
AAGAGGTGGAGCACGCCATGGTCTGGTGCACCGTGTTTGCCGACATCGAG
TGCTACGGTAATCGCACCTTTCTGCGCGCCGGAGTGCCCTGTGTCCGCTA
CACGGATCACTACTTTGTGACCACACTGATCTACAGCATGCTGCTGGGTT
TCCTCGGTATGGATCGCTTCTGTCTCGGTCAAACGGGCACGGCTGTGGGC
AAACTGCTTACCATGGGCGGCGTGGGCGTTTGGTGGATCATCGACGTCAT
CCTCCTGATCACCAACAATTTGCTGCCCGAGGACGGCAGCAATTGGAATC
CCTATGTCTAGACGTGTGTGATATGCCTCTGTGTCATAGCTTTAAGTAGT
TAAATAAGATTAATCTTGTTCACTGATTAATTCGTAGTGTTAGGAAATTA
AATTAACTTGCCCCTTATTTCATTATAAATACCTTTGTTATAAAATCATT
GAAATTAATAATTTCATACATATCTATTAGATGTAAAGTAAGGATAAATA
AATATTTAGAAGTACAGTTAAAAAAAAAAAAAAAAAA

LP03404.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:02:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG11103-RB 874 CG11103-RB 1..872 1..872 4360 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:06:06
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 13673242..13674110 1..869 4345 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:48:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:06:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13782513..13783384 1..872 4360 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13790611..13791482 1..872 4360 100 Plus
Blast to na_te.dros performed 2019-03-16 02:06:04
Subject Length Description Subject Range Query Range Score Percent Strand
Juan 4236 Juan JUAN 4236bp 4149..4236 771..861 142 65.2 Plus
gypsy12 10218 gypsy12 GYPSY12 10218bp 1557..1675 746..864 135 60.3 Plus
gypsy12 10218 gypsy12 GYPSY12 10218bp 9439..9557 746..864 135 60.3 Plus
TAHRE 10463 TAHRE OSV 10463bp 10155..10228 768..841 117 67.1 Plus

LP03404.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:07:17 Download gff for LP03404.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 13673242..13674110 1..869 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:35:01 Download gff for LP03404.complete
Subject Subject Range Query Range Percent Splice Strand
CG11103-RB 1..519 143..661 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:43:12 Download gff for LP03404.complete
Subject Subject Range Query Range Percent Splice Strand
CG11103-RB 1..519 143..661 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:11:11 Download gff for LP03404.complete
Subject Subject Range Query Range Percent Splice Strand
CG11103-RB 1..519 143..661 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:35:21 Download gff for LP03404.complete
Subject Subject Range Query Range Percent Splice Strand
CG11103-RB 1..519 143..661 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:57:27 Download gff for LP03404.complete
Subject Subject Range Query Range Percent Splice Strand
CG11103-RB 1..519 143..661 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:17:40 Download gff for LP03404.complete
Subject Subject Range Query Range Percent Splice Strand
CG11103-RB 1..869 1..869 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:43:12 Download gff for LP03404.complete
Subject Subject Range Query Range Percent Splice Strand
CG11103-RB 1..869 1..869 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:11:11 Download gff for LP03404.complete
Subject Subject Range Query Range Percent Splice Strand
CG11103-RB 55..923 1..869 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:35:21 Download gff for LP03404.complete
Subject Subject Range Query Range Percent Splice Strand
CG11103-RB 1..869 1..869 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:57:27 Download gff for LP03404.complete
Subject Subject Range Query Range Percent Splice Strand
CG11103-RB 55..923 1..869 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:17 Download gff for LP03404.complete
Subject Subject Range Query Range Percent Splice Strand
X 13782513..13783381 1..869 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:17 Download gff for LP03404.complete
Subject Subject Range Query Range Percent Splice Strand
X 13782513..13783381 1..869 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:17 Download gff for LP03404.complete
Subject Subject Range Query Range Percent Splice Strand
X 13782513..13783381 1..869 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:11:11 Download gff for LP03404.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13676546..13677414 1..869 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:07:43 Download gff for LP03404.complete
Subject Subject Range Query Range Percent Splice Strand
X 13790611..13791479 1..869 100   Plus

LP03404.hyp Sequence

Translation from 0 to 660

> LP03404.hyp
GLLAFLVARQHDAQAIQARSDKEQPQTVVSGTAVQSVVPVQAQLGSGMGP
SSSSSSASSASGGAGNSAFYPLGPNVMCSFLPRDFLDCKDPVDHRENATA
QQEKKYGCLKFGGSTYEEVEHAMVWCTVFADIECYGNRTFLRAGVPCVRY
TDHYFVTTLIYSMLLGFLGMDRFCLGQTGTAVGKLLTMGGVGVWWIIDVI
LLITNNLLPEDGSNWNPYV*

LP03404.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG11103-PB 172 CG11103-PB 1..172 48..219 939 100 Plus
amx-PB 284 CG12127-PB 195..281 126..213 184 45.5 Plus
amx-PA 284 CG12127-PA 195..281 126..213 184 45.5 Plus
CG10795-PA 178 CG10795-PA 34..150 88..213 173 35.9 Plus

LP03404.pep Sequence

Translation from 142 to 660

> LP03404.pep
MGPSSSSSSASSASGGAGNSAFYPLGPNVMCSFLPRDFLDCKDPVDHREN
ATAQQEKKYGCLKFGGSTYEEVEHAMVWCTVFADIECYGNRTFLRAGVPC
VRYTDHYFVTTLIYSMLLGFLGMDRFCLGQTGTAVGKLLTMGGVGVWWII
DVILLITNNLLPEDGSNWNPYV*

LP03404.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15960-PA 205 GF15960-PA 54..205 21..172 759 88.8 Plus
Dana\GF19095-PA 282 GF19095-PA 193..279 79..166 177 45.5 Plus
Dana\GF12097-PA 183 GF12097-PA 38..157 41..168 172 37.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17813-PA 223 GG17813-PA 53..223 1..172 904 97.7 Plus
Dere\GG18987-PA 285 GG18987-PA 196..282 79..166 176 45.5 Plus
Dere\GG20778-PA 178 GG20778-PA 34..152 41..168 170 36.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17747-PA 216 GH17747-PA 47..216 3..172 733 77.6 Plus
Dgri\GH12700-PA 275 GH12700-PA 186..272 79..166 177 44.3 Plus
Dgri\GH21182-PA 182 GH21182-PA 34..152 41..168 164 34.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG11103-PB 172 CG11103-PB 1..172 1..172 939 100 Plus
amx-PB 284 CG12127-PB 195..281 79..166 184 45.5 Plus
amx-PA 284 CG12127-PA 195..281 79..166 184 45.5 Plus
CG10795-PA 178 CG10795-PA 34..150 41..166 173 35.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:53:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15502-PA 218 GI15502-PA 50..218 4..172 747 78.7 Plus
Dmoj\GI20469-PA 183 GI20469-PA 35..153 41..168 176 36.2 Plus
Dmoj\GI14465-PA 268 GI14465-PA 179..265 79..166 173 44.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:53:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19845-PA 219 GL19845-PA 68..219 21..172 740 86.2 Plus
Dper\GL18280-PA 271 GL18280-PA 182..268 79..166 179 45.5 Plus
Dper\GL11844-PA 179 GL11844-PA 35..153 41..168 169 35.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10761-PA 219 GA10761-PA 68..219 21..172 740 86.2 Plus
Dpse\GA10564-PA 179 GA10564-PA 35..153 41..168 169 35.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17641-PA 224 GM17641-PA 53..224 1..172 924 98.8 Plus
Dsec\GM22327-PA 286 GM22327-PA 197..283 79..166 176 45.5 Plus
Dsec\GM15723-PA 178 GM15723-PA 34..152 41..168 170 36.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17144-PA 224 GD17144-PA 53..224 1..172 931 99.4 Plus
Dsim\GD24561-PA 285 GD24561-PA 196..282 79..166 176 45.5 Plus
Dsim\GD25200-PA 178 GD25200-PA 34..152 41..168 170 36.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19261-PA 220 GJ19261-PA 69..220 21..172 726 85.5 Plus
Dvir\GJ18800-PA 268 GJ18800-PA 179..265 79..166 177 45.5 Plus
Dvir\GJ22319-PA 182 GJ22319-PA 21..152 28..168 176 35.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25073-PA 218 GK25073-PA 68..218 22..172 727 86.8 Plus
Dwil\GK25793-PA 269 GK25793-PA 180..266 79..166 175 44.3 Plus
Dwil\GK20744-PA 179 GK20744-PA 21..151 28..166 163 35.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17109-PA 224 GE17109-PA 53..224 1..172 922 98.3 Plus
Dyak\GE15460-PA 283 GE15460-PA 194..280 79..166 176 45.5 Plus
Dyak\GE13716-PA 178 GE13716-PA 34..152 41..168 172 36.2 Plus