Clone LP03531 Report

Search the DGRC for LP03531

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:35
Well:31
Vector:pOT2
Associated Gene/TranscriptCG32284-RA
Protein status:LP03531.pep: gold
Sequenced Size:484

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14957 2002-01-01 Sim4 clustering to Release 2
CG32284 2002-05-18 Blastp of sequenced clone
CG32284 2003-01-01 Sim4 clustering to Release 3
CG32284 2008-04-29 Release 5.5 accounting
CG32284 2008-08-15 Release 5.9 accounting
CG32284 2008-12-18 5.12 accounting

Clone Sequence Records

LP03531.complete Sequence

484 bp (484 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119008

> LP03531.complete
GCTAATCATGTGGCTGCGTATAATGTTTTTACTGTTGCTGGCTCATTGCC
TCACGGCTTTGCCAGCTCCAGAGTTTGACGACCACAACTCGAAGACTTGG
AGTGCGGAAGAAGCCTGCAGCGAAGTTACAACCACCACCATAATGGAAAA
CCAGGCTGATCCAACTTGTAGAACCTACGTTTATTGTTACGTGGTCAATG
GATCAGTTTTGTCGTTGATTAAGAGCTGCAAAGTGAACCAGTACTTTGAT
CCCAATTTGAAAATGTGCCGGTCTGAAGTTCCAGATGAATGTTCTGCAAT
GGCACCAACCAACTAAATCCCACGGCATCTTTCATGCCACTTTGAACTTC
TGCAGCGCCAATAAGCTAGAGCTATATCTGAATTTCTTGGAACCCAAAGC
TTATAAATGTTTCAAATCTTGATGCCAATAAAAAGTAATAATAAATTATA
GCATTGCAAAAAAAAAAAAAAAAAAAAAAAAAAA

LP03531.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:54:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG32284.a 555 CG32284.a 78..536 1..459 2295 100 Plus
CG32284-RA 555 CG32284-RA 78..536 1..459 2295 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:14:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3186392..3186674 175..457 1415 100 Plus
chr3L 24539361 chr3L 3186188..3186328 34..174 705 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:48:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:14:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3186963..3187247 175..459 1425 100 Plus
3L 28110227 3L 3186759..3186899 34..174 705 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3186963..3187247 175..459 1425 100 Plus
3L 28103327 3L 3186759..3186899 34..174 705 100 Plus
3L 28103327 3L 3186664..3186697 1..34 170 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:14:20 has no hits.

LP03531.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:15:28 Download gff for LP03531.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3186189..3186328 35..174 100 -> Plus
chr3L 3186093..3186126 1..34 100 -> Plus
chr3L 3186392..3186674 175..457 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:35:03 Download gff for LP03531.complete
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..309 8..316 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:24 Download gff for LP03531.complete
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..309 8..316 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:56:43 Download gff for LP03531.complete
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..309 8..316 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:34:46 Download gff for LP03531.complete
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..309 8..316 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:30:16 Download gff for LP03531.complete
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..309 8..316 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:04:11 Download gff for LP03531.complete
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..457 1..457 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:23 Download gff for LP03531.complete
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..457 1..457 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:56:43 Download gff for LP03531.complete
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..457 1..457 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:34:46 Download gff for LP03531.complete
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..457 1..457 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:30:16 Download gff for LP03531.complete
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..457 1..457 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:15:28 Download gff for LP03531.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3186664..3186697 1..34 100 -> Plus
3L 3186760..3186899 35..174 100 -> Plus
3L 3186963..3187245 175..457 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:15:28 Download gff for LP03531.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3186664..3186697 1..34 100 -> Plus
3L 3186760..3186899 35..174 100 -> Plus
3L 3186963..3187245 175..457 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:15:28 Download gff for LP03531.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3186664..3186697 1..34 100 -> Plus
3L 3186760..3186899 35..174 100 -> Plus
3L 3186963..3187245 175..457 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:56:43 Download gff for LP03531.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3186664..3186697 1..34 100 -> Plus
arm_3L 3186760..3186899 35..174 100 -> Plus
arm_3L 3186963..3187245 175..457 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:16:44 Download gff for LP03531.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3186963..3187245 175..457 100   Plus
3L 3186664..3186697 1..34 100 -> Plus
3L 3186760..3186899 35..174 100 -> Plus

LP03531.hyp Sequence

Translation from 0 to 315

> LP03531.hyp
LIMWLRIMFLLLLAHCLTALPAPEFDDHNSKTWSAEEACSEVTTTTIMEN
QADPTCRTYVYCYVVNGSVLSLIKSCKVNQYFDPNLKMCRSEVPDECSAM
APTN*

LP03531.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:43:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG32284-PA 102 CG32284-PA 1..102 3..104 555 100 Plus
CG14957-PA 96 CG14957-PA 1..95 3..97 254 50.5 Plus
CG42494-PC 283 CG42494-PC 215..283 30..98 232 55.1 Plus
CG42494-PB 283 CG42494-PB 215..283 30..98 232 55.1 Plus
CG42494-PA 283 CG42494-PA 215..283 30..98 232 55.1 Plus
CG42494-PC 283 CG42494-PC 123..188 33..97 163 42.4 Plus
CG42494-PB 283 CG42494-PB 123..188 33..97 163 42.4 Plus

LP03531.pep Sequence

Translation from 7 to 315

> LP03531.pep
MWLRIMFLLLLAHCLTALPAPEFDDHNSKTWSAEEACSEVTTTTIMENQA
DPTCRTYVYCYVVNGSVLSLIKSCKVNQYFDPNLKMCRSEVPDECSAMAP
TN*

LP03531.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:28:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10120-PA 94 GF10120-PA 1..94 1..96 266 50 Plus
Dana\GF10119-PA 1575 GF10119-PA 1452..1516 31..95 173 43.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15110-PA 95 GG15110-PA 1..94 1..95 243 48.4 Plus
Dere\GG15109-PA 251 GG15109-PA 185..251 31..96 202 58.2 Plus
Dere\GG15109-PA 251 GG15109-PA 89..155 31..95 135 40.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG32284-PA 102 CG32284-PA 1..102 1..102 555 100 Plus
CG14957-PA 96 CG14957-PA 1..95 1..95 254 50.5 Plus
CG42494-PC 283 CG42494-PC 215..283 28..96 232 55.1 Plus
CG42494-PB 283 CG42494-PB 215..283 28..96 232 55.1 Plus
CG42494-PA 283 CG42494-PA 215..283 28..96 232 55.1 Plus
CG42494-PC 283 CG42494-PC 123..188 31..95 163 42.4 Plus
CG42494-PB 283 CG42494-PB 123..188 31..95 163 42.4 Plus
CG42494-PA 283 CG42494-PA 123..188 31..95 163 42.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:28:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24893-PA 91 GL24893-PA 1..90 1..95 182 38.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:28:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16810-PB 90 GA16810-PB 20..89 26..95 185 47.1 Plus
Dpse\GA30028-PB 237 GA30028-PB 169..237 29..96 172 49.3 Plus
Dpse\GA30028-PB 237 GA30028-PB 77..150 29..101 164 41.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:28:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14544-PA 102 GM14544-PA 1..102 1..102 489 89.2 Plus
Dsec\GM14546-PA 96 GM14546-PA 1..95 1..95 243 47.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:28:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13736-PA 105 GD13736-PA 1..102 1..102 481 86.3 Plus
Dsim\GD13737-PA 96 GD13737-PA 1..95 1..95 246 48.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19152-PA 90 GK19152-PA 8..87 19..95 167 40 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:28:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21336-PA 147 GE21336-PA 1..99 1..99 340 71.7 Plus
Dyak\GE21337-PA 96 GE21337-PA 1..95 1..95 265 50.5 Plus