LP03531.complete Sequence
484 bp (484 high quality bases) assembled on 2002-05-18
GenBank Submission: AY119008
> LP03531.complete
GCTAATCATGTGGCTGCGTATAATGTTTTTACTGTTGCTGGCTCATTGCC
TCACGGCTTTGCCAGCTCCAGAGTTTGACGACCACAACTCGAAGACTTGG
AGTGCGGAAGAAGCCTGCAGCGAAGTTACAACCACCACCATAATGGAAAA
CCAGGCTGATCCAACTTGTAGAACCTACGTTTATTGTTACGTGGTCAATG
GATCAGTTTTGTCGTTGATTAAGAGCTGCAAAGTGAACCAGTACTTTGAT
CCCAATTTGAAAATGTGCCGGTCTGAAGTTCCAGATGAATGTTCTGCAAT
GGCACCAACCAACTAAATCCCACGGCATCTTTCATGCCACTTTGAACTTC
TGCAGCGCCAATAAGCTAGAGCTATATCTGAATTTCTTGGAACCCAAAGC
TTATAAATGTTTCAAATCTTGATGCCAATAAAAAGTAATAATAAATTATA
GCATTGCAAAAAAAAAAAAAAAAAAAAAAAAAAA
LP03531.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:54:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32284.a | 555 | CG32284.a | 78..536 | 1..459 | 2295 | 100 | Plus |
CG32284-RA | 555 | CG32284-RA | 78..536 | 1..459 | 2295 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:14:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 3186392..3186674 | 175..457 | 1415 | 100 | Plus |
chr3L | 24539361 | chr3L | 3186188..3186328 | 34..174 | 705 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:48:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:14:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3186963..3187247 | 175..459 | 1425 | 100 | Plus |
3L | 28110227 | 3L | 3186759..3186899 | 34..174 | 705 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 3186963..3187247 | 175..459 | 1425 | 100 | Plus |
3L | 28103327 | 3L | 3186759..3186899 | 34..174 | 705 | 100 | Plus |
3L | 28103327 | 3L | 3186664..3186697 | 1..34 | 170 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 16:14:20 has no hits.
LP03531.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:15:28 Download gff for
LP03531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 3186189..3186328 | 35..174 | 100 | -> | Plus |
chr3L | 3186093..3186126 | 1..34 | 100 | -> | Plus |
chr3L | 3186392..3186674 | 175..457 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:35:03 Download gff for
LP03531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32284-RA | 1..309 | 8..316 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:24 Download gff for
LP03531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32284-RA | 1..309 | 8..316 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:56:43 Download gff for
LP03531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32284-RA | 1..309 | 8..316 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:34:46 Download gff for
LP03531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32284-RA | 1..309 | 8..316 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:30:16 Download gff for
LP03531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32284-RA | 1..309 | 8..316 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:04:11 Download gff for
LP03531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32284-RA | 1..457 | 1..457 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:23 Download gff for
LP03531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32284-RA | 1..457 | 1..457 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:56:43 Download gff for
LP03531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32284-RA | 1..457 | 1..457 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:34:46 Download gff for
LP03531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32284-RA | 1..457 | 1..457 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:30:16 Download gff for
LP03531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32284-RA | 1..457 | 1..457 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:15:28 Download gff for
LP03531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3186664..3186697 | 1..34 | 100 | -> | Plus |
3L | 3186760..3186899 | 35..174 | 100 | -> | Plus |
3L | 3186963..3187245 | 175..457 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:15:28 Download gff for
LP03531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3186664..3186697 | 1..34 | 100 | -> | Plus |
3L | 3186760..3186899 | 35..174 | 100 | -> | Plus |
3L | 3186963..3187245 | 175..457 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:15:28 Download gff for
LP03531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3186664..3186697 | 1..34 | 100 | -> | Plus |
3L | 3186760..3186899 | 35..174 | 100 | -> | Plus |
3L | 3186963..3187245 | 175..457 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:56:43 Download gff for
LP03531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3186664..3186697 | 1..34 | 100 | -> | Plus |
arm_3L | 3186760..3186899 | 35..174 | 100 | -> | Plus |
arm_3L | 3186963..3187245 | 175..457 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:16:44 Download gff for
LP03531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3186963..3187245 | 175..457 | 100 | | Plus |
3L | 3186664..3186697 | 1..34 | 100 | -> | Plus |
3L | 3186760..3186899 | 35..174 | 100 | -> | Plus |
LP03531.hyp Sequence
Translation from 0 to 315
> LP03531.hyp
LIMWLRIMFLLLLAHCLTALPAPEFDDHNSKTWSAEEACSEVTTTTIMEN
QADPTCRTYVYCYVVNGSVLSLIKSCKVNQYFDPNLKMCRSEVPDECSAM
APTN*
LP03531.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:43:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32284-PA | 102 | CG32284-PA | 1..102 | 3..104 | 555 | 100 | Plus |
CG14957-PA | 96 | CG14957-PA | 1..95 | 3..97 | 254 | 50.5 | Plus |
CG42494-PC | 283 | CG42494-PC | 215..283 | 30..98 | 232 | 55.1 | Plus |
CG42494-PB | 283 | CG42494-PB | 215..283 | 30..98 | 232 | 55.1 | Plus |
CG42494-PA | 283 | CG42494-PA | 215..283 | 30..98 | 232 | 55.1 | Plus |
CG42494-PC | 283 | CG42494-PC | 123..188 | 33..97 | 163 | 42.4 | Plus |
CG42494-PB | 283 | CG42494-PB | 123..188 | 33..97 | 163 | 42.4 | Plus |
LP03531.pep Sequence
Translation from 7 to 315
> LP03531.pep
MWLRIMFLLLLAHCLTALPAPEFDDHNSKTWSAEEACSEVTTTTIMENQA
DPTCRTYVYCYVVNGSVLSLIKSCKVNQYFDPNLKMCRSEVPDECSAMAP
TN*
LP03531.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:28:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF10120-PA | 94 | GF10120-PA | 1..94 | 1..96 | 266 | 50 | Plus |
Dana\GF10119-PA | 1575 | GF10119-PA | 1452..1516 | 31..95 | 173 | 43.1 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:28:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15110-PA | 95 | GG15110-PA | 1..94 | 1..95 | 243 | 48.4 | Plus |
Dere\GG15109-PA | 251 | GG15109-PA | 185..251 | 31..96 | 202 | 58.2 | Plus |
Dere\GG15109-PA | 251 | GG15109-PA | 89..155 | 31..95 | 135 | 40.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32284-PA | 102 | CG32284-PA | 1..102 | 1..102 | 555 | 100 | Plus |
CG14957-PA | 96 | CG14957-PA | 1..95 | 1..95 | 254 | 50.5 | Plus |
CG42494-PC | 283 | CG42494-PC | 215..283 | 28..96 | 232 | 55.1 | Plus |
CG42494-PB | 283 | CG42494-PB | 215..283 | 28..96 | 232 | 55.1 | Plus |
CG42494-PA | 283 | CG42494-PA | 215..283 | 28..96 | 232 | 55.1 | Plus |
CG42494-PC | 283 | CG42494-PC | 123..188 | 31..95 | 163 | 42.4 | Plus |
CG42494-PB | 283 | CG42494-PB | 123..188 | 31..95 | 163 | 42.4 | Plus |
CG42494-PA | 283 | CG42494-PA | 123..188 | 31..95 | 163 | 42.4 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:28:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL24893-PA | 91 | GL24893-PA | 1..90 | 1..95 | 182 | 38.9 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:28:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA16810-PB | 90 | GA16810-PB | 20..89 | 26..95 | 185 | 47.1 | Plus |
Dpse\GA30028-PB | 237 | GA30028-PB | 169..237 | 29..96 | 172 | 49.3 | Plus |
Dpse\GA30028-PB | 237 | GA30028-PB | 77..150 | 29..101 | 164 | 41.9 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:28:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM14544-PA | 102 | GM14544-PA | 1..102 | 1..102 | 489 | 89.2 | Plus |
Dsec\GM14546-PA | 96 | GM14546-PA | 1..95 | 1..95 | 243 | 47.4 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:28:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD13736-PA | 105 | GD13736-PA | 1..102 | 1..102 | 481 | 86.3 | Plus |
Dsim\GD13737-PA | 96 | GD13737-PA | 1..95 | 1..95 | 246 | 48.4 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:28:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK19152-PA | 90 | GK19152-PA | 8..87 | 19..95 | 167 | 40 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:28:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21336-PA | 147 | GE21336-PA | 1..99 | 1..99 | 340 | 71.7 | Plus |
Dyak\GE21337-PA | 96 | GE21337-PA | 1..95 | 1..95 | 265 | 50.5 | Plus |