BDGP Sequence Production Resources |
Search the DGRC for LP03829
Library: | LP |
Tissue Source: | Drosophila melanogaster larval-early pupal |
Created by: | Ling Hong |
Date Registered: | 1998-06-11 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 38 |
Well: | 29 |
Vector: | pOT2 |
Associated Gene/Transcript | Ssk-RA |
Protein status: | LP03829.pep: gold |
Preliminary Size: | 2496 |
Sequenced Size: | 820 |
Gene | Date | Evidence |
---|---|---|
CG6981 | 2001-01-01 | Release 2 assignment |
CG6981 | 2001-07-04 | Blastp of sequenced clone |
CG6981 | 2003-01-01 | Sim4 clustering to Release 3 |
CG6981 | 2008-04-29 | Release 5.5 accounting |
CG6981 | 2008-08-15 | Release 5.9 accounting |
CG6981 | 2008-12-18 | 5.12 accounting |
820 bp (820 high quality bases) assembled on 2001-07-04
GenBank Submission: AY052037
> LP03829.complete CGATACGAAAACGAATCATTTCGCTGTAGTTTCCGCGTGAAAATTACAGA AAAGATTCTCAGCGATAAGAGCAATCAGCATATCTAGTGCGAAATGGTGT CCGTGGAGACTGTAGGCTCTATTTTCATCAAGGCCCTGAAGCTGATCATC AATCTGGTGATCATCTTCTTGTACCGTTGGGGCGATGGTGGCGAATTCCT GGGCATCGGCGGCACGTGGAACTTAAACGAGGAGAAGAGCGCCGATGCGG AAATCGTAGCCTCAGGCGTCATGGTTGGATTCTTGATTTACACTGGATGC CACACCATTGCCTTTGCCTTCGGCACAACCAAACATAAGGGAGAGCTGTG CGACACCATCATGAACGTGGTTGGCTGCATCATGTGGATCGCCGTGGGCG GAGTGGCACTCCACTACTGGAAGGGTTACATGTCCGACGAGGGATTCCTG TATGTGAACTCGGAGCGTCAAGTGGGCATTGCCATGGGCTCGCTGTGCGT TATCGAGGGCGCACTGTACCTGCTGGACACCGTGTTGGCTTGCATACACT ATTCGAAGGGCGACACCGACTACACGCAGTAGAAACTGAATAGTGGGGAT ACCAATCGCAGCCGCCGAATAAACACCATCCACATTTGTCTTTATACATA GATCGATTTAAGTGCAAATTAGTTATTATCCGCAATCAATTATCAACTAT ACGTTCGTAAGGGTCAATTGTCGCTGTACTATACACTAACTGTTTACAAT TTTCATTCACGTTTAACATCCTTAAATTGGCAAATACAAATAGTTAAGAC CAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG6981-RA | 1052 | CG6981-RA | 190..991 | 1..802 | 4010 | 100 | Plus |
CG6981.a | 860 | CG6981.a | 60..856 | 1..802 | 3910 | 99.3 | Plus |
CG6981-RB | 1113 | CG6981-RB | 308..1052 | 58..802 | 3725 | 100 | Plus |
CG6981-RB | 1113 | CG6981-RB | 190..246 | 1..57 | 285 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 20178515..20178975 | 341..801 | 2305 | 100 | Plus |
chr3L | 24539361 | chr3L | 20178187..20178384 | 144..341 | 990 | 100 | Plus |
chr3L | 24539361 | chr3L | 20177872..20177958 | 58..144 | 435 | 100 | Plus |
chr3L | 24539361 | chr3L | 20177754..20177810 | 1..57 | 285 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 20189319..20189780 | 341..802 | 2310 | 100 | Plus |
3L | 28110227 | 3L | 20188991..20189188 | 144..341 | 990 | 100 | Plus |
3L | 28110227 | 3L | 20188676..20188762 | 58..144 | 435 | 100 | Plus |
3L | 28110227 | 3L | 20188558..20188614 | 1..57 | 285 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 20182419..20182880 | 341..802 | 2310 | 100 | Plus |
3L | 28103327 | 3L | 20182091..20182288 | 144..341 | 990 | 100 | Plus |
3L | 28103327 | 3L | 20181776..20181862 | 58..144 | 435 | 100 | Plus |
3L | 28103327 | 3L | 20181658..20181714 | 1..57 | 285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 20178516..20178975 | 342..801 | 100 | Plus | |
chr3L | 20177754..20177810 | 1..57 | 100 | -> | Plus |
chr3L | 20177872..20177958 | 58..144 | 100 | -> | Plus |
chr3L | 20178188..20178384 | 145..341 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6981-RA | 1..489 | 94..582 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6981-RA | 1..489 | 94..582 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ssk-RB | 1..489 | 94..582 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6981-RA | 1..489 | 94..582 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ssk-RB | 1..489 | 94..582 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6981-RA | 1..801 | 1..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6981-RA | 60..860 | 1..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ssk-RA | 37..837 | 1..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6981-RA | 1..801 | 1..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ssk-RA | 37..837 | 1..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 20188558..20188614 | 1..57 | 100 | -> | Plus |
3L | 20188676..20188762 | 58..144 | 100 | -> | Plus |
3L | 20188992..20189188 | 145..341 | 100 | -> | Plus |
3L | 20189320..20189779 | 342..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 20188558..20188614 | 1..57 | 100 | -> | Plus |
3L | 20188676..20188762 | 58..144 | 100 | -> | Plus |
3L | 20188992..20189188 | 145..341 | 100 | -> | Plus |
3L | 20189320..20189779 | 342..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 20188558..20188614 | 1..57 | 100 | -> | Plus |
3L | 20188676..20188762 | 58..144 | 100 | -> | Plus |
3L | 20188992..20189188 | 145..341 | 100 | -> | Plus |
3L | 20189320..20189779 | 342..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 20181658..20181714 | 1..57 | 100 | -> | Plus |
arm_3L | 20181776..20181862 | 58..144 | 100 | -> | Plus |
arm_3L | 20182092..20182288 | 145..341 | 100 | -> | Plus |
arm_3L | 20182420..20182879 | 342..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 20181658..20181714 | 1..57 | 100 | -> | Plus |
3L | 20181776..20181862 | 58..144 | 100 | -> | Plus |
3L | 20182092..20182288 | 145..341 | 100 | -> | Plus |
3L | 20182420..20182879 | 342..801 | 100 | Plus |
Translation from 93 to 581
> LP03829.pep MVSVETVGSIFIKALKLIINLVIIFLYRWGDGGEFLGIGGTWNLNEEKSA DAEIVASGVMVGFLIYTGCHTIAFAFGTTKHKGELCDTIMNVVGCIMWIA VGGVALHYWKGYMSDEGFLYVNSERQVGIAMGSLCVIEGALYLLDTVLAC IHYSKGDTDYTQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF25311-PA | 162 | GF25311-PA | 1..162 | 1..162 | 822 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16083-PA | 162 | GG16083-PA | 1..162 | 1..162 | 826 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15117-PA | 162 | GH15117-PA | 1..162 | 1..162 | 796 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Ssk-PA | 162 | CG6981-PA | 1..162 | 1..162 | 857 | 100 | Plus |
Ssk-PB | 162 | CG6981-PB | 1..162 | 1..162 | 857 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13768-PA | 162 | GI13768-PA | 1..162 | 1..162 | 809 | 96.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25117-PA | 162 | GL25117-PA | 1..162 | 1..162 | 823 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20002-PA | 162 | GA20002-PA | 1..162 | 1..162 | 823 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22258-PA | 162 | GM22258-PA | 1..162 | 1..162 | 821 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14857-PA | 162 | GD14857-PA | 1..162 | 1..162 | 835 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13758-PA | 162 | GJ13758-PA | 1..162 | 1..162 | 802 | 95.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16939-PA | 162 | GK16939-PA | 1..162 | 1..162 | 814 | 96.3 | Plus |
Translation from 93 to 581
> LP03829.hyp MVSVETVGSIFIKALKLIINLVIIFLYRWGDGGEFLGIGGTWNLNEEKSA DAEIVASGVMVGFLIYTGCHTIAFAFGTTKHKGELCDTIMNVVGCIMWIA VGGVALHYWKGYMSDEGFLYVNSERQVGIAMGSLCVIEGALYLLDTVLAC IHYSKGDTDYTQ*