Clone LP03829 Report

Search the DGRC for LP03829

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:38
Well:29
Vector:pOT2
Associated Gene/TranscriptSsk-RA
Protein status:LP03829.pep: gold
Preliminary Size:2496
Sequenced Size:820

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6981 2001-01-01 Release 2 assignment
CG6981 2001-07-04 Blastp of sequenced clone
CG6981 2003-01-01 Sim4 clustering to Release 3
CG6981 2008-04-29 Release 5.5 accounting
CG6981 2008-08-15 Release 5.9 accounting
CG6981 2008-12-18 5.12 accounting

Clone Sequence Records

LP03829.complete Sequence

820 bp (820 high quality bases) assembled on 2001-07-04

GenBank Submission: AY052037

> LP03829.complete
CGATACGAAAACGAATCATTTCGCTGTAGTTTCCGCGTGAAAATTACAGA
AAAGATTCTCAGCGATAAGAGCAATCAGCATATCTAGTGCGAAATGGTGT
CCGTGGAGACTGTAGGCTCTATTTTCATCAAGGCCCTGAAGCTGATCATC
AATCTGGTGATCATCTTCTTGTACCGTTGGGGCGATGGTGGCGAATTCCT
GGGCATCGGCGGCACGTGGAACTTAAACGAGGAGAAGAGCGCCGATGCGG
AAATCGTAGCCTCAGGCGTCATGGTTGGATTCTTGATTTACACTGGATGC
CACACCATTGCCTTTGCCTTCGGCACAACCAAACATAAGGGAGAGCTGTG
CGACACCATCATGAACGTGGTTGGCTGCATCATGTGGATCGCCGTGGGCG
GAGTGGCACTCCACTACTGGAAGGGTTACATGTCCGACGAGGGATTCCTG
TATGTGAACTCGGAGCGTCAAGTGGGCATTGCCATGGGCTCGCTGTGCGT
TATCGAGGGCGCACTGTACCTGCTGGACACCGTGTTGGCTTGCATACACT
ATTCGAAGGGCGACACCGACTACACGCAGTAGAAACTGAATAGTGGGGAT
ACCAATCGCAGCCGCCGAATAAACACCATCCACATTTGTCTTTATACATA
GATCGATTTAAGTGCAAATTAGTTATTATCCGCAATCAATTATCAACTAT
ACGTTCGTAAGGGTCAATTGTCGCTGTACTATACACTAACTGTTTACAAT
TTTCATTCACGTTTAACATCCTTAAATTGGCAAATACAAATAGTTAAGAC
CAAAAAAAAAAAAAAAAAAA

LP03829.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:27:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG6981-RA 1052 CG6981-RA 190..991 1..802 4010 100 Plus
CG6981.a 860 CG6981.a 60..856 1..802 3910 99.3 Plus
CG6981-RB 1113 CG6981-RB 308..1052 58..802 3725 100 Plus
CG6981-RB 1113 CG6981-RB 190..246 1..57 285 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:49:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20178515..20178975 341..801 2305 100 Plus
chr3L 24539361 chr3L 20178187..20178384 144..341 990 100 Plus
chr3L 24539361 chr3L 20177872..20177958 58..144 435 100 Plus
chr3L 24539361 chr3L 20177754..20177810 1..57 285 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:48:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:49:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20189319..20189780 341..802 2310 100 Plus
3L 28110227 3L 20188991..20189188 144..341 990 100 Plus
3L 28110227 3L 20188676..20188762 58..144 435 100 Plus
3L 28110227 3L 20188558..20188614 1..57 285 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:50:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20182419..20182880 341..802 2310 100 Plus
3L 28103327 3L 20182091..20182288 144..341 990 100 Plus
3L 28103327 3L 20181776..20181862 58..144 435 100 Plus
3L 28103327 3L 20181658..20181714 1..57 285 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:49:32 has no hits.

LP03829.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:50:28 Download gff for LP03829.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20178516..20178975 342..801 100   Plus
chr3L 20177754..20177810 1..57 100 -> Plus
chr3L 20177872..20177958 58..144 100 -> Plus
chr3L 20178188..20178384 145..341 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:35:14 Download gff for LP03829.complete
Subject Subject Range Query Range Percent Splice Strand
CG6981-RA 1..489 94..582 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:14:27 Download gff for LP03829.complete
Subject Subject Range Query Range Percent Splice Strand
CG6981-RA 1..489 94..582 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:40:01 Download gff for LP03829.complete
Subject Subject Range Query Range Percent Splice Strand
Ssk-RB 1..489 94..582 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:45:47 Download gff for LP03829.complete
Subject Subject Range Query Range Percent Splice Strand
CG6981-RA 1..489 94..582 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:22:26 Download gff for LP03829.complete
Subject Subject Range Query Range Percent Splice Strand
Ssk-RB 1..489 94..582 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:07:36 Download gff for LP03829.complete
Subject Subject Range Query Range Percent Splice Strand
CG6981-RA 1..801 1..801 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:14:27 Download gff for LP03829.complete
Subject Subject Range Query Range Percent Splice Strand
CG6981-RA 60..860 1..801 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:40:01 Download gff for LP03829.complete
Subject Subject Range Query Range Percent Splice Strand
Ssk-RA 37..837 1..801 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:45:47 Download gff for LP03829.complete
Subject Subject Range Query Range Percent Splice Strand
CG6981-RA 1..801 1..801 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:22:26 Download gff for LP03829.complete
Subject Subject Range Query Range Percent Splice Strand
Ssk-RA 37..837 1..801 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:50:28 Download gff for LP03829.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20188558..20188614 1..57 100 -> Plus
3L 20188676..20188762 58..144 100 -> Plus
3L 20188992..20189188 145..341 100 -> Plus
3L 20189320..20189779 342..801 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:50:28 Download gff for LP03829.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20188558..20188614 1..57 100 -> Plus
3L 20188676..20188762 58..144 100 -> Plus
3L 20188992..20189188 145..341 100 -> Plus
3L 20189320..20189779 342..801 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:50:28 Download gff for LP03829.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20188558..20188614 1..57 100 -> Plus
3L 20188676..20188762 58..144 100 -> Plus
3L 20188992..20189188 145..341 100 -> Plus
3L 20189320..20189779 342..801 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:40:01 Download gff for LP03829.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20181658..20181714 1..57 100 -> Plus
arm_3L 20181776..20181862 58..144 100 -> Plus
arm_3L 20182092..20182288 145..341 100 -> Plus
arm_3L 20182420..20182879 342..801 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:23:36 Download gff for LP03829.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20181658..20181714 1..57 100 -> Plus
3L 20181776..20181862 58..144 100 -> Plus
3L 20182092..20182288 145..341 100 -> Plus
3L 20182420..20182879 342..801 100   Plus

LP03829.pep Sequence

Translation from 93 to 581

> LP03829.pep
MVSVETVGSIFIKALKLIINLVIIFLYRWGDGGEFLGIGGTWNLNEEKSA
DAEIVASGVMVGFLIYTGCHTIAFAFGTTKHKGELCDTIMNVVGCIMWIA
VGGVALHYWKGYMSDEGFLYVNSERQVGIAMGSLCVIEGALYLLDTVLAC
IHYSKGDTDYTQ*

LP03829.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25311-PA 162 GF25311-PA 1..162 1..162 822 98.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16083-PA 162 GG16083-PA 1..162 1..162 826 98.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15117-PA 162 GH15117-PA 1..162 1..162 796 95.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:51
Subject Length Description Subject Range Query Range Score Percent Strand
Ssk-PA 162 CG6981-PA 1..162 1..162 857 100 Plus
Ssk-PB 162 CG6981-PB 1..162 1..162 857 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13768-PA 162 GI13768-PA 1..162 1..162 809 96.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:33:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25117-PA 162 GL25117-PA 1..162 1..162 823 98.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:33:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20002-PA 162 GA20002-PA 1..162 1..162 823 98.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:33:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22258-PA 162 GM22258-PA 1..162 1..162 821 98.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:33:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14857-PA 162 GD14857-PA 1..162 1..162 835 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13758-PA 162 GJ13758-PA 1..162 1..162 802 95.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16939-PA 162 GK16939-PA 1..162 1..162 814 96.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:33:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19647-PA 162 GE19647-PA 1..162 1..162 835 100 Plus
Dyak\GE23065-PA 162 GE23065-PA 1..162 1..162 830 99.4 Plus

LP03829.hyp Sequence

Translation from 93 to 581

> LP03829.hyp
MVSVETVGSIFIKALKLIINLVIIFLYRWGDGGEFLGIGGTWNLNEEKSA
DAEIVASGVMVGFLIYTGCHTIAFAFGTTKHKGELCDTIMNVVGCIMWIA
VGGVALHYWKGYMSDEGFLYVNSERQVGIAMGSLCVIEGALYLLDTVLAC
IHYSKGDTDYTQ*

LP03829.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:14:04
Subject Length Description Subject Range Query Range Score Percent Strand
Ssk-PA 162 CG6981-PA 1..162 1..162 857 100 Plus
Ssk-PB 162 CG6981-PB 1..162 1..162 857 100 Plus