LP03851.complete Sequence
394 bp (394 high quality bases) assembled on 2002-05-18
GenBank Submission: AY119009
> LP03851.complete
ATAATTCAAACAGAAATCATTTACCAAGCTCCGTGAGAACCTTTTCCAAT
ATGATGCAGATCAAGTACTTGTTCGCCCTCTTCGCTGTCCTGATGCTGGT
GGTCCTGGGAGCCAACGAGGCCGATGCCGACTGCCTGTCCGGAAGATACA
AGGGTCCCTGTGCCGTCTGGGACAACGAGACCTGTCGTCGTGTGTGCAAG
GAGGAGGGACGCTCCAGTGGCCACTGCAGCCCCAGTCTGAAGTGCTGGTG
CGAAGGATGCTAAATCCATGAGCAATTAGCATGAACGTTCTGAAAAGCGC
GTTTAGCTCTCCACTACTTACACATATTCTATGCTGCAATATTGAAAATC
TAATAAACAAAACTAATGTACATTAAAAAAAAAAAAAAAAAAAA
LP03851.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:02:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Drs-RA | 376 | Drs-RA | 1..376 | 1..376 | 1880 | 100 | Plus |
dro5-RA | 336 | dro5-RA | 76..235 | 103..262 | 560 | 90 | Plus |
dro6-RA | 219 | dro6-RA | 1..161 | 51..211 | 400 | 83.2 | Plus |
dro6-RA | 219 | dro6-RA | 172..217 | 216..261 | 140 | 86.9 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:15:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 3368993..3369366 | 1..374 | 1855 | 99.7 | Plus |
chr3L | 24539361 | chr3L | 3316290..3316449 | 103..262 | 560 | 90 | Plus |
chr3L | 24539361 | chr3L | 3313783..3314001 | 51..269 | 480 | 81.3 | Plus |
chr3L | 24539361 | chr3L | 3335582..3335802 | 265..51 | 425 | 80.5 | Minus |
chr3L | 24539361 | chr3L | 3335018..3335158 | 264..124 | 255 | 78.7 | Minus |
chr3L | 24539361 | chr3L | 3315190..3315256 | 195..261 | 185 | 85.1 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:48:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:15:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3369569..3369944 | 1..376 | 1880 | 100 | Plus |
3L | 28110227 | 3L | 3316884..3317043 | 103..262 | 560 | 90 | Plus |
3L | 28110227 | 3L | 3314375..3314593 | 51..269 | 495 | 81.7 | Plus |
3L | 28110227 | 3L | 3336142..3336362 | 265..51 | 410 | 80.1 | Minus |
3L | 28110227 | 3L | 3335578..3335759 | 264..83 | 265 | 76.4 | Minus |
3L | 28110227 | 3L | 3315784..3315850 | 195..261 | 185 | 85.1 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:34:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 3369569..3369944 | 1..376 | 1880 | 100 | Plus |
3L | 28103327 | 3L | 3316884..3317043 | 103..262 | 560 | 90 | Plus |
3L | 28103327 | 3L | 3314375..3314593 | 51..269 | 495 | 81.7 | Plus |
3L | 28103327 | 3L | 3336202..3336362 | 211..51 | 400 | 83.2 | Minus |
3L | 28103327 | 3L | 3335578..3335628 | 264..214 | 210 | 94.1 | Minus |
3L | 28103327 | 3L | 3315784..3315850 | 195..261 | 185 | 85 | Plus |
3L | 28103327 | 3L | 3335668..3335759 | 174..83 | 160 | 78.2 | Minus |
3L | 28103327 | 3L | 3336142..3336191 | 265..216 | 145 | 86 | Minus |
Blast to na_te.dros performed on 2019-03-16 11:15:58 has no hits.
LP03851.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:17:07 Download gff for
LP03851.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 3368993..3369366 | 1..374 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:35:15 Download gff for
LP03851.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drs-RA | 1..213 | 51..263 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:43:16 Download gff for
LP03851.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drs-RA | 1..213 | 51..263 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:10:37 Download gff for
LP03851.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drs-RA | 1..213 | 51..263 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:35:24 Download gff for
LP03851.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drs-RA | 1..213 | 51..263 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:09:35 Download gff for
LP03851.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drs-RA | 1..213 | 51..263 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:17:45 Download gff for
LP03851.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drs-RA | 1..374 | 1..374 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:43:16 Download gff for
LP03851.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drs-RA | 1..374 | 1..374 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:10:37 Download gff for
LP03851.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drs-RA | 14..387 | 1..374 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:35:25 Download gff for
LP03851.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drs-RA | 1..374 | 1..374 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:09:35 Download gff for
LP03851.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drs-RA | 14..387 | 1..374 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:17:07 Download gff for
LP03851.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3369569..3369942 | 1..374 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:17:07 Download gff for
LP03851.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3369569..3369942 | 1..374 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:17:07 Download gff for
LP03851.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3369569..3369942 | 1..374 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:10:37 Download gff for
LP03851.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3369569..3369942 | 1..374 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:07:47 Download gff for
LP03851.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3369569..3369942 | 1..374 | 100 | | Plus |
LP03851.hyp Sequence
Translation from 2 to 262
> LP03851.hyp
NSNRNHLPSSVRTFSNMMQIKYLFALFAVLMLVVLGANEADADCLSGRYK
GPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC*
LP03851.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:36:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Drs-PA | 70 | CG10810-PA | 1..70 | 17..86 | 394 | 100 | Plus |
Drsl5-PA | 69 | CG10812-PA | 1..69 | 18..86 | 338 | 82.6 | Plus |
Drsl2-PA | 70 | CG32279-PA | 1..70 | 17..86 | 328 | 78.6 | Plus |
Drsl6-PA | 72 | CG32268-PA | 1..72 | 17..86 | 324 | 77.8 | Plus |
Drsl1-PA | 69 | CG32274-PA | 1..69 | 18..86 | 278 | 66.7 | Plus |
LP03851.pep Sequence
Translation from 50 to 262
> LP03851.pep
MMQIKYLFALFAVLMLVVLGANEADADCLSGRYKGPCAVWDNETCRRVCK
EEGRSSGHCSPSLKCWCEGC*
LP03851.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:54:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF24279-PA | 69 | GF24279-PA | 1..69 | 2..70 | 332 | 88.4 | Plus |
Dana\GF10208-PA | 69 | GF10208-PA | 1..69 | 2..70 | 329 | 87 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:54:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15135-PA | 70 | GG15135-PA | 1..70 | 1..70 | 366 | 98.6 | Plus |
Dere\GG14261-PA | 72 | GG14261-PA | 1..72 | 1..70 | 313 | 81.9 | Plus |
Dere\GG15129-PA | 69 | GG15129-PA | 1..69 | 2..70 | 312 | 81.2 | Plus |
Dere\GG15126-PA | 70 | GG15126-PA | 1..70 | 1..70 | 280 | 71.4 | Plus |
Dere\GG14262-PA | 69 | GG14262-PA | 1..69 | 2..70 | 260 | 69.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Drs-PA | 70 | CG10810-PA | 1..70 | 1..70 | 394 | 100 | Plus |
Drsl5-PA | 69 | CG10812-PA | 1..69 | 2..70 | 338 | 82.6 | Plus |
Drsl2-PA | 70 | CG32279-PA | 1..70 | 1..70 | 328 | 78.6 | Plus |
Drsl6-PA | 72 | CG32268-PA | 1..72 | 1..70 | 324 | 77.8 | Plus |
Drsl1-PA | 69 | CG32274-PA | 1..69 | 2..70 | 278 | 66.7 | Plus |
Drsl4-PA | 71 | CG32282-PA | 1..71 | 1..70 | 257 | 66.2 | Plus |
Drsl3-PA | 71 | CG32283-PA | 1..71 | 1..70 | 230 | 56.3 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:54:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM14569-PA | 72 | GM14569-PA | 1..70 | 1..70 | 365 | 98.6 | Plus |
Dsec\GM14560-PA | 70 | GM14560-PA | 1..70 | 1..70 | 308 | 78.6 | Plus |
Dsec\GM14562-PA | 69 | GM14562-PA | 1..69 | 2..70 | 304 | 79.7 | Plus |
Dsec\GM14055-PA | 69 | GM14055-PA | 1..69 | 2..70 | 261 | 68.1 | Plus |
Dsec\GM14054-PA | 72 | GM14054-PA | 1..72 | 1..70 | 247 | 79.2 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:54:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\Drs-PA | 70 | GD13760-PA | 1..70 | 1..70 | 369 | 100 | Plus |
Dsim\dro5-PA | 69 | GD13754-PA | 1..69 | 2..70 | 316 | 82.6 | Plus |
Dsim\dro1-PA | 69 | GD13331-PA | 1..69 | 2..70 | 277 | 72.5 | Plus |
Dsim\dro6-PA | 72 | GD13330-PA | 1..72 | 1..70 | 247 | 79.2 | Plus |
Dsim\dro4-PA | 71 | GD13753-PA | 1..71 | 1..70 | 240 | 66.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:54:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21361-PA | 70 | GE21361-PA | 1..70 | 1..70 | 369 | 100 | Plus |
Dyak\GE21355-PA | 69 | GE21355-PA | 1..69 | 2..70 | 312 | 81.2 | Plus |
Dyak\GE20688-PA | 72 | GE20688-PA | 1..72 | 1..70 | 311 | 80.6 | Plus |
Dyak\GE21352-PA | 70 | GE21352-PA | 1..70 | 1..70 | 288 | 72.9 | Plus |
Dyak\GE20689-PA | 69 | GE20689-PA | 1..69 | 2..70 | 270 | 71 | Plus |