Clone LP03851 Report

Search the DGRC for LP03851

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:38
Well:51
Vector:pOT2
Associated Gene/TranscriptDrs-RA
Protein status:LP03851.pep: gold
Preliminary Size:376
Sequenced Size:394

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10810 2002-01-01 Sim4 clustering to Release 2
CG10810 2002-05-18 Blastp of sequenced clone
CG10810 2003-01-01 Sim4 clustering to Release 3
Drs 2008-04-29 Release 5.5 accounting
Drs 2008-08-15 Release 5.9 accounting
Drs 2008-12-18 5.12 accounting

Clone Sequence Records

LP03851.complete Sequence

394 bp (394 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119009

> LP03851.complete
ATAATTCAAACAGAAATCATTTACCAAGCTCCGTGAGAACCTTTTCCAAT
ATGATGCAGATCAAGTACTTGTTCGCCCTCTTCGCTGTCCTGATGCTGGT
GGTCCTGGGAGCCAACGAGGCCGATGCCGACTGCCTGTCCGGAAGATACA
AGGGTCCCTGTGCCGTCTGGGACAACGAGACCTGTCGTCGTGTGTGCAAG
GAGGAGGGACGCTCCAGTGGCCACTGCAGCCCCAGTCTGAAGTGCTGGTG
CGAAGGATGCTAAATCCATGAGCAATTAGCATGAACGTTCTGAAAAGCGC
GTTTAGCTCTCCACTACTTACACATATTCTATGCTGCAATATTGAAAATC
TAATAAACAAAACTAATGTACATTAAAAAAAAAAAAAAAAAAAA

LP03851.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:02:18
Subject Length Description Subject Range Query Range Score Percent Strand
Drs-RA 376 Drs-RA 1..376 1..376 1880 100 Plus
dro5-RA 336 dro5-RA 76..235 103..262 560 90 Plus
dro6-RA 219 dro6-RA 1..161 51..211 400 83.2 Plus
dro6-RA 219 dro6-RA 172..217 216..261 140 86.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:15:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3368993..3369366 1..374 1855 99.7 Plus
chr3L 24539361 chr3L 3316290..3316449 103..262 560 90 Plus
chr3L 24539361 chr3L 3313783..3314001 51..269 480 81.3 Plus
chr3L 24539361 chr3L 3335582..3335802 265..51 425 80.5 Minus
chr3L 24539361 chr3L 3335018..3335158 264..124 255 78.7 Minus
chr3L 24539361 chr3L 3315190..3315256 195..261 185 85.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:48:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3369569..3369944 1..376 1880 100 Plus
3L 28110227 3L 3316884..3317043 103..262 560 90 Plus
3L 28110227 3L 3314375..3314593 51..269 495 81.7 Plus
3L 28110227 3L 3336142..3336362 265..51 410 80.1 Minus
3L 28110227 3L 3335578..3335759 264..83 265 76.4 Minus
3L 28110227 3L 3315784..3315850 195..261 185 85.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3369569..3369944 1..376 1880 100 Plus
3L 28103327 3L 3316884..3317043 103..262 560 90 Plus
3L 28103327 3L 3314375..3314593 51..269 495 81.7 Plus
3L 28103327 3L 3336202..3336362 211..51 400 83.2 Minus
3L 28103327 3L 3335578..3335628 264..214 210 94.1 Minus
3L 28103327 3L 3315784..3315850 195..261 185 85 Plus
3L 28103327 3L 3335668..3335759 174..83 160 78.2 Minus
3L 28103327 3L 3336142..3336191 265..216 145 86 Minus
Blast to na_te.dros performed on 2019-03-16 11:15:58 has no hits.

LP03851.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:17:07 Download gff for LP03851.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3368993..3369366 1..374 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:35:15 Download gff for LP03851.complete
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 1..213 51..263 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:43:16 Download gff for LP03851.complete
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 1..213 51..263 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:10:37 Download gff for LP03851.complete
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 1..213 51..263 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:35:24 Download gff for LP03851.complete
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 1..213 51..263 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:09:35 Download gff for LP03851.complete
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 1..213 51..263 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:17:45 Download gff for LP03851.complete
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 1..374 1..374 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:43:16 Download gff for LP03851.complete
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 1..374 1..374 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:10:37 Download gff for LP03851.complete
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 14..387 1..374 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:35:25 Download gff for LP03851.complete
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 1..374 1..374 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:09:35 Download gff for LP03851.complete
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 14..387 1..374 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:17:07 Download gff for LP03851.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3369569..3369942 1..374 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:17:07 Download gff for LP03851.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3369569..3369942 1..374 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:17:07 Download gff for LP03851.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3369569..3369942 1..374 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:10:37 Download gff for LP03851.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3369569..3369942 1..374 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:07:47 Download gff for LP03851.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3369569..3369942 1..374 100   Plus

LP03851.hyp Sequence

Translation from 2 to 262

> LP03851.hyp
NSNRNHLPSSVRTFSNMMQIKYLFALFAVLMLVVLGANEADADCLSGRYK
GPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC*

LP03851.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
Drs-PA 70 CG10810-PA 1..70 17..86 394 100 Plus
Drsl5-PA 69 CG10812-PA 1..69 18..86 338 82.6 Plus
Drsl2-PA 70 CG32279-PA 1..70 17..86 328 78.6 Plus
Drsl6-PA 72 CG32268-PA 1..72 17..86 324 77.8 Plus
Drsl1-PA 69 CG32274-PA 1..69 18..86 278 66.7 Plus

LP03851.pep Sequence

Translation from 50 to 262

> LP03851.pep
MMQIKYLFALFAVLMLVVLGANEADADCLSGRYKGPCAVWDNETCRRVCK
EEGRSSGHCSPSLKCWCEGC*

LP03851.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24279-PA 69 GF24279-PA 1..69 2..70 332 88.4 Plus
Dana\GF10208-PA 69 GF10208-PA 1..69 2..70 329 87 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15135-PA 70 GG15135-PA 1..70 1..70 366 98.6 Plus
Dere\GG14261-PA 72 GG14261-PA 1..72 1..70 313 81.9 Plus
Dere\GG15129-PA 69 GG15129-PA 1..69 2..70 312 81.2 Plus
Dere\GG15126-PA 70 GG15126-PA 1..70 1..70 280 71.4 Plus
Dere\GG14262-PA 69 GG14262-PA 1..69 2..70 260 69.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:57
Subject Length Description Subject Range Query Range Score Percent Strand
Drs-PA 70 CG10810-PA 1..70 1..70 394 100 Plus
Drsl5-PA 69 CG10812-PA 1..69 2..70 338 82.6 Plus
Drsl2-PA 70 CG32279-PA 1..70 1..70 328 78.6 Plus
Drsl6-PA 72 CG32268-PA 1..72 1..70 324 77.8 Plus
Drsl1-PA 69 CG32274-PA 1..69 2..70 278 66.7 Plus
Drsl4-PA 71 CG32282-PA 1..71 1..70 257 66.2 Plus
Drsl3-PA 71 CG32283-PA 1..71 1..70 230 56.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14569-PA 72 GM14569-PA 1..70 1..70 365 98.6 Plus
Dsec\GM14560-PA 70 GM14560-PA 1..70 1..70 308 78.6 Plus
Dsec\GM14562-PA 69 GM14562-PA 1..69 2..70 304 79.7 Plus
Dsec\GM14055-PA 69 GM14055-PA 1..69 2..70 261 68.1 Plus
Dsec\GM14054-PA 72 GM14054-PA 1..72 1..70 247 79.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Drs-PA 70 GD13760-PA 1..70 1..70 369 100 Plus
Dsim\dro5-PA 69 GD13754-PA 1..69 2..70 316 82.6 Plus
Dsim\dro1-PA 69 GD13331-PA 1..69 2..70 277 72.5 Plus
Dsim\dro6-PA 72 GD13330-PA 1..72 1..70 247 79.2 Plus
Dsim\dro4-PA 71 GD13753-PA 1..71 1..70 240 66.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21361-PA 70 GE21361-PA 1..70 1..70 369 100 Plus
Dyak\GE21355-PA 69 GE21355-PA 1..69 2..70 312 81.2 Plus
Dyak\GE20688-PA 72 GE20688-PA 1..72 1..70 311 80.6 Plus
Dyak\GE21352-PA 70 GE21352-PA 1..70 1..70 288 72.9 Plus
Dyak\GE20689-PA 69 GE20689-PA 1..69 2..70 270 71 Plus