Clone LP04037 Report

Search the DGRC for LP04037

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:40
Well:37
Vector:pOT2
Associated Gene/TranscriptCG3604-RA
Protein status:LP04037.pep: gold
Preliminary Size:536
Sequenced Size:554

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3604 2002-01-01 Sim4 clustering to Release 2
CG3604 2002-05-18 Blastp of sequenced clone
CG3604 2003-01-01 Sim4 clustering to Release 3
CG3604 2008-04-29 Release 5.5 accounting
CG3604 2008-08-15 Release 5.9 accounting
CG3604 2008-12-18 5.12 accounting

Clone Sequence Records

LP04037.complete Sequence

554 bp (554 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119012

> LP04037.complete
CTCGAAATGTGCTTTAGATATAGCTTCAGTTTCATAGTATTCGCGGCTGT
TCTGCTCCTGGCAGCCGGAATTCGTGCAGCTCCCTCGGATGTCGTCGTGG
AGAAGGCGGAGGAGCCCGCGGTGGCCAAACCCCTGCCTGATGCCAGTGAG
CTCACTGTTCCGGAGGACTGTCATCAGCCCAAGGAAACCGGTCGCTGTTT
CGCTCTGTTCTATCGCTACGCCTACAACGTGGATACACAATCCTGCGAGG
AGTTCGTTTACGGTGGATGTGCCGGCAACAAGAACAACTTCGAATCCAAG
GAGCAGTGCGAACAGGCATGTTTGGTAAAGTCTGCGGTTTCCTCCACGGA
CTCAACAACCGAACAAAACAGCGAAGTGGCCACAGAAACTAGCACCTCGT
CTTAAAAAATTGTAGTTCTTAGTTTGTAATTTATTTGTCATCCAACTTCA
TCAGCCTTTTAAAAGCATTTCTTTACTGAGTTGATTATTTGAATAATTTG
ATTATAAATTTTAATAAATATACCATTGTGATTTATAAAAAAAAAAAAAA
AAAA

LP04037.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG3604-RA 631 CG3604-RA 96..631 1..536 2680 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3696752..3697287 536..1 2560 98.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:48:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:49:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3697241..3697777 537..1 2685 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3697241..3697777 537..1 2685 100 Minus
Blast to na_te.dros performed on 2019-03-16 02:49:39 has no hits.

LP04037.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:50:33 Download gff for LP04037.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3696752..3697287 1..536 91   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:35:24 Download gff for LP04037.complete
Subject Subject Range Query Range Percent Splice Strand
CG3604-RA 1..399 7..405 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:43:20 Download gff for LP04037.complete
Subject Subject Range Query Range Percent Splice Strand
CG3604-RA 1..399 7..405 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:40:04 Download gff for LP04037.complete
Subject Subject Range Query Range Percent Splice Strand
CG3604-RA 1..399 7..405 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:35:28 Download gff for LP04037.complete
Subject Subject Range Query Range Percent Splice Strand
CG3604-RA 1..399 7..405 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:22:35 Download gff for LP04037.complete
Subject Subject Range Query Range Percent Splice Strand
CG3604-RA 1..399 7..405 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:17:50 Download gff for LP04037.complete
Subject Subject Range Query Range Percent Splice Strand
CG3604-RA 96..631 1..536 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:43:20 Download gff for LP04037.complete
Subject Subject Range Query Range Percent Splice Strand
CG3604-RA 96..631 1..536 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:40:04 Download gff for LP04037.complete
Subject Subject Range Query Range Percent Splice Strand
CG3604-RA 36..571 1..536 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:35:28 Download gff for LP04037.complete
Subject Subject Range Query Range Percent Splice Strand
CG3604-RA 1..536 1..536 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:22:35 Download gff for LP04037.complete
Subject Subject Range Query Range Percent Splice Strand
CG3604-RA 36..571 1..536 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:50:33 Download gff for LP04037.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3697242..3697777 1..536 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:50:33 Download gff for LP04037.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3697242..3697777 1..536 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:50:33 Download gff for LP04037.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3697242..3697777 1..536 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:40:04 Download gff for LP04037.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3697242..3697777 1..536 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:07:51 Download gff for LP04037.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3697242..3697777 1..536 100   Minus

LP04037.hyp Sequence

Translation from 0 to 404

> LP04037.hyp
LEMCFRYSFSFIVFAAVLLLAAGIRAAPSDVVVEKAEEPAVAKPLPDASE
LTVPEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESK
EQCEQACLVKSAVSSTDSTTEQNSEVATETSTSS*

LP04037.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG3604-PB 132 CG3604-PB 1..132 3..134 685 100 Plus
CG3604-PA 132 CG3604-PA 1..132 3..134 685 100 Plus
CG10031-PA 129 CG10031-PA 56..128 38..110 155 39.7 Plus
CG2816-PB 84 CG2816-PB 31..81 57..107 152 51 Plus
CG13748-PA 113 CG13748-PA 8..110 11..107 146 35 Plus

LP04037.pep Sequence

Translation from 6 to 404

> LP04037.pep
MCFRYSFSFIVFAAVLLLAAGIRAAPSDVVVEKAEEPAVAKPLPDASELT
VPEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQ
CEQACLVKSAVSSTDSTTEQNSEVATETSTSS*

LP04037.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:55:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14653-PA 137 GF14653-PA 1..137 1..132 451 66.7 Plus
Dana\GF14652-PA 126 GF14652-PA 1..120 1..106 161 33.1 Plus
Dana\GF14660-PA 97 GF14660-PA 41..94 55..108 141 48.1 Plus
Dana\GF14656-PA 88 GF14656-PA 26..86 52..105 139 39.3 Plus
Dana\GF15248-PA 82 GF15248-PA 29..79 55..105 138 49 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:55:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24408-PA 132 GG24408-PA 1..132 1..132 649 92.4 Plus
Dere\GG20657-PA 762 GG20657-PA 620..695 43..107 161 42.1 Plus
Dere\GG24407-PA 128 GG24407-PA 53..128 34..109 155 40.8 Plus
Dere\GG24416-PA 78 GG24416-PA 23..77 53..106 150 49.1 Plus
Dere\GG24959-PA 83 GG24959-PA 30..80 55..105 145 51 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:55:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13178-PA 135 GH13178-PA 1..120 3..127 353 57 Plus
Dgri\GH13701-PA 81 GH13701-PA 28..78 55..105 148 52.9 Plus
Dgri\GH13177-PA 120 GH13177-PA 65..117 55..107 141 49.1 Plus
Dgri\GH13180-PA 81 GH13180-PA 38..81 63..106 132 52.3 Plus
Dgri\GH13188-PA 94 GH13188-PA 38..92 55..109 131 45.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG3604-PB 132 CG3604-PB 1..132 1..132 685 100 Plus
CG3604-PA 132 CG3604-PA 1..132 1..132 685 100 Plus
CG10031-PA 129 CG10031-PA 56..128 36..108 155 39.7 Plus
CG2816-PB 84 CG2816-PB 31..81 55..105 152 51 Plus
CG13748-PA 113 CG13748-PA 8..110 9..105 146 35 Plus
CG15418-PB 97 CG15418-PB 41..92 55..106 144 48.1 Plus
CG15418-PA 97 CG15418-PA 41..92 55..106 144 48.1 Plus
Acp24A4-PC 78 CG31779-PC 33..77 62..106 139 48.9 Plus
Acp24A4-PB 78 CG31779-PB 33..77 62..106 139 48.9 Plus
IM33-PB 82 CG16712-PB 38..80 63..105 137 48.8 Plus
IM33-PA 82 CG16712-PA 38..80 63..105 137 48.8 Plus
CG3513-PA 88 CG3513-PA 26..86 52..105 137 37.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17756-PA 142 GI17756-PA 1..134 1..132 305 47.4 Plus
Dmoj\GI17755-PA 121 GI17755-PA 10..121 9..109 170 37.7 Plus
Dmoj\GI23887-PA 88 GI23887-PA 35..85 55..105 152 54.9 Plus
Dmoj\GI21218-PA 766 GI21218-PA 644..696 53..105 150 50.9 Plus
Dmoj\GI17765-PA 95 GI17765-PA 39..93 55..109 134 45.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19458-PA 129 GL19458-PA 1..128 1..132 411 61.5 Plus
Dper\GL18667-PA 88 GL18667-PA 18..85 39..105 154 47.8 Plus
Dper\GL11519-PA 766 GL11519-PA 621..703 43..114 149 36.1 Plus
Dper\GL19461-PA 78 GL19461-PA 15..77 46..106 140 42.9 Plus
Dper\GL19427-PA 78 GL19427-PA 25..76 55..105 137 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17552-PA 129 GA17552-PA 1..128 1..132 404 60 Plus
Dpse\GA15472-PA 88 GA15472-PA 18..85 39..105 154 47.8 Plus
Dpse\GA25967-PA 123 GA25967-PA 6..122 9..108 149 30.8 Plus
Dpse\fat-spondin-PA 766 GA19979-PA 621..703 43..114 149 36.1 Plus
Dpse\GA25970-PA 78 GA25970-PA 15..77 46..106 140 42.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18125-PA 130 GM18125-PA 1..130 1..132 621 90.9 Plus
Dsec\GM18124-PA 130 GM18124-PA 71..130 51..109 145 45 Plus
Dsec\GM18428-PA 91 GM18428-PA 38..88 55..105 144 51 Plus
Dsec\GM18133-PA 97 GM18133-PA 41..94 55..108 134 46.3 Plus
Dsec\GM18130-PA 88 GM18130-PA 26..86 52..105 132 37.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22733-PA 130 GD22733-PA 1..130 1..132 631 93.2 Plus
Dsim\GD22732-PA 131 GD22732-PA 72..131 51..109 146 45 Plus
Dsim\GD23247-PA 91 GD23247-PA 38..88 55..105 144 51 Plus
Dsim\GD22741-PA 97 GD22741-PA 41..94 55..108 135 46.3 Plus
Dsim\GD22737-PA 88 GD22737-PA 26..86 52..105 132 37.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:55:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17584-PA 144 GJ17584-PA 1..137 1..132 356 55.3 Plus
Dvir\GJ17583-PA 126 GJ17583-PA 71..126 54..109 150 48.2 Plus
Dvir\GJ21147-PA 85 GJ21147-PA 32..82 55..105 149 51 Plus
Dvir\GJ21125-PA 80 GJ21125-PA 29..79 56..106 142 45.1 Plus
Dvir\GJ20820-PA 770 GJ20820-PA 645..695 55..105 140 45.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:55:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15468-PA 117 GK15468-PA 1..90 15..108 290 61.1 Plus
Dwil\GK15467-PA 111 GK15467-PA 7..111 6..109 167 36.2 Plus
Dwil\GK15466-PA 103 GK15466-PA 12..103 9..109 153 34.7 Plus
Dwil\GK17866-PA 730 GK17866-PA 589..673 43..119 149 38.6 Plus
Dwil\GK14644-PA 82 GK14644-PA 29..79 55..105 147 51 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:55:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14811-PA 130 GE14811-PA 1..130 1..132 633 93.2 Plus
Dyak\GE14809-PA 127 GE14809-PA 52..127 34..109 155 40.8 Plus
Dyak\GE18250-PA 84 GE18250-PA 31..81 55..105 143 51 Plus
Dyak\GE19242-PA 116 GE19242-PA 13..113 11..105 140 36.6 Plus
Dyak\GE14827-PA 97 GE14827-PA 41..94 55..108 139 46.3 Plus