LP04160.complete Sequence
413 bp (413 high quality bases) assembled on 2002-05-18
GenBank Submission: AY119014
> LP04160.complete
ATAAGTTCCAGTCAACAGCCAAAAAGTTTAATACTTAAATTATGCATACT
ACAGCAGTTGTGACCCTATTTTCTGTCCTGCTTGTGGTCTTGGTGGCTGG
ACAAAATCGGAACTGCGACGAGTTGACCCGGAGATGTGAACGCTGTGTGG
AAACATTGAATAATGCAGCTGATCGTAACCTGCCCGTCCTCAATCAAGAG
TGCAGAACTAAGACTCGGAACAATTGGCGTTGGAGGAATGTAGGACGTTG
TGAGCTGACCAGGCTGAACTGCTTGGGTTCTAATCGACGCATGAACTGTA
ATGATATTGCTGAACTCGCTGGCATGGATCGTATTAATTAATAATGATAA
AAATGCTTGTTTATTGATTGAAAATAAAAACACCAGAGAGCATTGAAAAA
AAAAAAAAAAAAA
LP04160.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:02:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Eig71Ed-RA | 453 | Eig71Ed-RA | 21..419 | 1..399 | 1995 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:11:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 15642602..15642805 | 75..278 | 1020 | 100 | Plus |
chr3L | 24539361 | chr3L | 15642879..15642998 | 276..395 | 600 | 100 | Plus |
chr3L | 24539361 | chr3L | 15642459..15642533 | 1..75 | 375 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:48:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:11:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 15652700..15652903 | 75..278 | 1020 | 100 | Plus |
3L | 28110227 | 3L | 15652977..15653100 | 276..399 | 620 | 100 | Plus |
3L | 28110227 | 3L | 15652557..15652631 | 1..75 | 375 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:33:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 15645800..15646003 | 75..278 | 1020 | 100 | Plus |
3L | 28103327 | 3L | 15646077..15646200 | 276..399 | 620 | 100 | Plus |
3L | 28103327 | 3L | 15645657..15645731 | 1..75 | 375 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 22:11:07 has no hits.
LP04160.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:12:14 Download gff for
LP04160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 15642459..15642533 | 1..75 | 100 | -> | Plus |
chr3L | 15642603..15642803 | 76..276 | 100 | -> | Plus |
chr3L | 15642880..15642998 | 277..395 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:35:30 Download gff for
LP04160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ed-RA | 1..300 | 42..341 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:43:04 Download gff for
LP04160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ed-RA | 1..300 | 42..341 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:11:57 Download gff for
LP04160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ed-RA | 1..300 | 42..341 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:35:14 Download gff for
LP04160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ed-RA | 1..300 | 42..341 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:36:26 Download gff for
LP04160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ed-RA | 1..300 | 42..341 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:17:30 Download gff for
LP04160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ed-RA | 14..408 | 1..395 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:43:04 Download gff for
LP04160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ed-RA | 14..408 | 1..395 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:11:57 Download gff for
LP04160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ed-RA | 21..415 | 1..395 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:35:14 Download gff for
LP04160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ed-RA | 14..408 | 1..395 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:36:26 Download gff for
LP04160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ed-RA | 21..415 | 1..395 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:12:14 Download gff for
LP04160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15652701..15652901 | 76..276 | 100 | -> | Plus |
3L | 15652978..15653096 | 277..395 | 100 | | Plus |
3L | 15652557..15652631 | 1..75 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:12:14 Download gff for
LP04160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15652701..15652901 | 76..276 | 100 | -> | Plus |
3L | 15652978..15653096 | 277..395 | 100 | | Plus |
3L | 15652557..15652631 | 1..75 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:12:14 Download gff for
LP04160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15652701..15652901 | 76..276 | 100 | -> | Plus |
3L | 15652978..15653096 | 277..395 | 100 | | Plus |
3L | 15652557..15652631 | 1..75 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:11:57 Download gff for
LP04160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 15645801..15646001 | 76..276 | 100 | -> | Plus |
arm_3L | 15645657..15645731 | 1..75 | 100 | -> | Plus |
arm_3L | 15646078..15646196 | 277..395 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:07:35 Download gff for
LP04160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15645657..15645731 | 1..75 | 100 | -> | Plus |
3L | 15645801..15646001 | 76..276 | 100 | -> | Plus |
3L | 15646078..15646196 | 277..395 | 100 | | Plus |
LP04160.hyp Sequence
Translation from 41 to 340
> LP04160.hyp
MHTTAVVTLFSVLLVVLVAGQNRNCDELTRRCERCVETLNNAADRNLPVL
NQECRTKTRNNWRWRNVGRCELTRLNCLGSNRRMNCNDIAELAGMDRIN*
LP04160.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:22:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Eig71Ed-PA | 99 | CG7350-PA | 1..99 | 1..99 | 532 | 100 | Plus |
Eig71Ea-PA | 100 | CG16931-PA | 1..97 | 1..97 | 327 | 59.8 | Plus |
Eig71Ef-PA | 98 | CG7599-PA | 1..96 | 1..97 | 182 | 37.1 | Plus |
Eig71Ej-PA | 98 | CG7588-PA | 1..97 | 1..98 | 163 | 32.7 | Plus |
Eig71Eh-PB | 101 | CG7594-PB | 5..95 | 7..98 | 161 | 33.7 | Plus |
LP04160.pep Sequence
Translation from 41 to 340
> LP04160.pep
MHTTAVVTLFSVLLVVLVAGQNRNCDELTRRCERCVETLNNAADRNLPVL
NQECRTKTRNNWRWRNVGRCELTRLNCLGSNRRMNCNDIAELAGMDRIN*
LP04160.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:55:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF10385-PA | 102 | GF10385-PA | 1..102 | 1..99 | 290 | 54.9 | Plus |
Dana\GF24087-PA | 73 | GF24087-PA | 1..71 | 28..98 | 208 | 50.7 | Plus |
Dana\GF10381-PA | 99 | GF10381-PA | 1..96 | 1..97 | 169 | 32 | Plus |
Dana\GF10380-PA | 101 | GF10380-PA | 1..96 | 1..97 | 150 | 33 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:55:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15918-PA | 99 | GG15918-PA | 1..99 | 1..99 | 427 | 82.8 | Plus |
Dere\GG13530-PA | 100 | GG13530-PA | 1..97 | 1..97 | 285 | 54.6 | Plus |
Dere\GG13527-PA | 98 | GG13527-PA | 1..96 | 1..97 | 175 | 37.1 | Plus |
Dere\GG13526-PA | 101 | GG13526-PA | 10..95 | 12..98 | 151 | 34.5 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Eig71Ed-PA | 99 | CG7350-PA | 1..99 | 1..99 | 532 | 100 | Plus |
Eig71Ea-PA | 100 | CG16931-PA | 1..97 | 1..97 | 327 | 59.8 | Plus |
Eig71Ef-PA | 98 | CG7599-PA | 1..96 | 1..97 | 182 | 37.1 | Plus |
Eig71Ej-PA | 98 | CG7588-PA | 1..97 | 1..98 | 163 | 32.7 | Plus |
Eig71Eh-PB | 101 | CG7594-PB | 5..95 | 7..98 | 161 | 33.7 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:55:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL24985-PA | 85 | GL24985-PA | 16..84 | 16..82 | 202 | 59.4 | Plus |
Dper\GL25491-PA | 98 | GL25491-PA | 1..96 | 1..97 | 169 | 37.1 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:55:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA20285-PA | 100 | GA20285-PA | 1..98 | 1..98 | 315 | 63.3 | Plus |
Dpse\GA23630-PA | 214 | GA23630-PA | 122..212 | 10..98 | 273 | 58.2 | Plus |
Dpse\GA20470-PA | 98 | GA20470-PA | 1..96 | 1..97 | 174 | 38.1 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:55:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25550-PA | 99 | GM25550-PA | 1..99 | 1..99 | 397 | 91.9 | Plus |
Dsec\GM24474-PA | 100 | GM24474-PA | 1..97 | 1..97 | 303 | 56.7 | Plus |
Dsec\GM24471-PA | 98 | GM24471-PA | 1..96 | 1..97 | 164 | 38.1 | Plus |
Dsec\GM24470-PA | 98 | GM24470-PA | 1..97 | 1..98 | 142 | 32.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:55:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14563-PA | 99 | GD14563-PA | 1..99 | 1..99 | 388 | 87.9 | Plus |
Dsim\GD12548-PA | 100 | GD12548-PA | 1..80 | 1..80 | 263 | 58.8 | Plus |
Dsim\GD12545-PA | 98 | GD12545-PA | 1..96 | 1..97 | 171 | 36.1 | Plus |
Dsim\GD12544-PA | 101 | GD12544-PA | 10..96 | 12..99 | 151 | 34.1 | Plus |
Dsim\GD12543-PA | 98 | GD12543-PA | 1..97 | 1..98 | 142 | 32.7 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:55:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ11358-PA | 96 | GJ11358-PA | 18..91 | 17..95 | 141 | 35.4 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:55:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK15124-PA | 144 | GK15124-PA | 1..97 | 1..97 | 264 | 51.5 | Plus |
Dwil\GK20707-PA | 100 | GK20707-PA | 3..98 | 6..97 | 158 | 36.1 | Plus |
Dwil\GK20696-PA | 102 | GK20696-PA | 1..97 | 1..97 | 151 | 31.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:55:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE22265-PA | 100 | GE22265-PA | 1..99 | 1..99 | 411 | 78.8 | Plus |
Dyak\GE23155-PA | 100 | GE23155-PA | 1..99 | 1..99 | 406 | 77.8 | Plus |
Dyak\GE19825-PA | 100 | GE19825-PA | 1..97 | 1..97 | 313 | 61.9 | Plus |
Dyak\GE22833-PA | 100 | GE22833-PA | 1..97 | 1..97 | 309 | 59.8 | Plus |
Dyak\GE22830-PA | 98 | GE22830-PA | 1..96 | 1..97 | 173 | 38.1 | Plus |