Clone LP04160 Report

Search the DGRC for LP04160

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:41
Well:60
Vector:pOT2
Associated Gene/TranscriptEig71Ed-RA
Protein status:LP04160.pep: gold
Preliminary Size:416
Sequenced Size:413

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7350 2002-01-01 Sim4 clustering to Release 2
CG7350 2002-05-18 Blastp of sequenced clone
CG7350 2003-01-01 Sim4 clustering to Release 3
Eig71Ed 2008-04-29 Release 5.5 accounting
Eig71Ed 2008-08-15 Release 5.9 accounting
Eig71Ed 2008-12-18 5.12 accounting

Clone Sequence Records

LP04160.complete Sequence

413 bp (413 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119014

> LP04160.complete
ATAAGTTCCAGTCAACAGCCAAAAAGTTTAATACTTAAATTATGCATACT
ACAGCAGTTGTGACCCTATTTTCTGTCCTGCTTGTGGTCTTGGTGGCTGG
ACAAAATCGGAACTGCGACGAGTTGACCCGGAGATGTGAACGCTGTGTGG
AAACATTGAATAATGCAGCTGATCGTAACCTGCCCGTCCTCAATCAAGAG
TGCAGAACTAAGACTCGGAACAATTGGCGTTGGAGGAATGTAGGACGTTG
TGAGCTGACCAGGCTGAACTGCTTGGGTTCTAATCGACGCATGAACTGTA
ATGATATTGCTGAACTCGCTGGCATGGATCGTATTAATTAATAATGATAA
AAATGCTTGTTTATTGATTGAAAATAAAAACACCAGAGAGCATTGAAAAA
AAAAAAAAAAAAA

LP04160.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:02:08
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ed-RA 453 Eig71Ed-RA 21..419 1..399 1995 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:11:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15642602..15642805 75..278 1020 100 Plus
chr3L 24539361 chr3L 15642879..15642998 276..395 600 100 Plus
chr3L 24539361 chr3L 15642459..15642533 1..75 375 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:48:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:11:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15652700..15652903 75..278 1020 100 Plus
3L 28110227 3L 15652977..15653100 276..399 620 100 Plus
3L 28110227 3L 15652557..15652631 1..75 375 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15645800..15646003 75..278 1020 100 Plus
3L 28103327 3L 15646077..15646200 276..399 620 100 Plus
3L 28103327 3L 15645657..15645731 1..75 375 100 Plus
Blast to na_te.dros performed on 2019-03-16 22:11:07 has no hits.

LP04160.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:12:14 Download gff for LP04160.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15642459..15642533 1..75 100 -> Plus
chr3L 15642603..15642803 76..276 100 -> Plus
chr3L 15642880..15642998 277..395 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:35:30 Download gff for LP04160.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ed-RA 1..300 42..341 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:43:04 Download gff for LP04160.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ed-RA 1..300 42..341 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:11:57 Download gff for LP04160.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ed-RA 1..300 42..341 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:35:14 Download gff for LP04160.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ed-RA 1..300 42..341 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:36:26 Download gff for LP04160.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ed-RA 1..300 42..341 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:17:30 Download gff for LP04160.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ed-RA 14..408 1..395 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:43:04 Download gff for LP04160.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ed-RA 14..408 1..395 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:11:57 Download gff for LP04160.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ed-RA 21..415 1..395 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:35:14 Download gff for LP04160.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ed-RA 14..408 1..395 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:36:26 Download gff for LP04160.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ed-RA 21..415 1..395 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:12:14 Download gff for LP04160.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15652701..15652901 76..276 100 -> Plus
3L 15652978..15653096 277..395 100   Plus
3L 15652557..15652631 1..75 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:12:14 Download gff for LP04160.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15652701..15652901 76..276 100 -> Plus
3L 15652978..15653096 277..395 100   Plus
3L 15652557..15652631 1..75 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:12:14 Download gff for LP04160.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15652701..15652901 76..276 100 -> Plus
3L 15652978..15653096 277..395 100   Plus
3L 15652557..15652631 1..75 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:11:57 Download gff for LP04160.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15645801..15646001 76..276 100 -> Plus
arm_3L 15645657..15645731 1..75 100 -> Plus
arm_3L 15646078..15646196 277..395 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:07:35 Download gff for LP04160.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15645657..15645731 1..75 100 -> Plus
3L 15645801..15646001 76..276 100 -> Plus
3L 15646078..15646196 277..395 100   Plus

LP04160.hyp Sequence

Translation from 41 to 340

> LP04160.hyp
MHTTAVVTLFSVLLVVLVAGQNRNCDELTRRCERCVETLNNAADRNLPVL
NQECRTKTRNNWRWRNVGRCELTRLNCLGSNRRMNCNDIAELAGMDRIN*

LP04160.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:22:09
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ed-PA 99 CG7350-PA 1..99 1..99 532 100 Plus
Eig71Ea-PA 100 CG16931-PA 1..97 1..97 327 59.8 Plus
Eig71Ef-PA 98 CG7599-PA 1..96 1..97 182 37.1 Plus
Eig71Ej-PA 98 CG7588-PA 1..97 1..98 163 32.7 Plus
Eig71Eh-PB 101 CG7594-PB 5..95 7..98 161 33.7 Plus

LP04160.pep Sequence

Translation from 41 to 340

> LP04160.pep
MHTTAVVTLFSVLLVVLVAGQNRNCDELTRRCERCVETLNNAADRNLPVL
NQECRTKTRNNWRWRNVGRCELTRLNCLGSNRRMNCNDIAELAGMDRIN*

LP04160.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10385-PA 102 GF10385-PA 1..102 1..99 290 54.9 Plus
Dana\GF24087-PA 73 GF24087-PA 1..71 28..98 208 50.7 Plus
Dana\GF10381-PA 99 GF10381-PA 1..96 1..97 169 32 Plus
Dana\GF10380-PA 101 GF10380-PA 1..96 1..97 150 33 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15918-PA 99 GG15918-PA 1..99 1..99 427 82.8 Plus
Dere\GG13530-PA 100 GG13530-PA 1..97 1..97 285 54.6 Plus
Dere\GG13527-PA 98 GG13527-PA 1..96 1..97 175 37.1 Plus
Dere\GG13526-PA 101 GG13526-PA 10..95 12..98 151 34.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ed-PA 99 CG7350-PA 1..99 1..99 532 100 Plus
Eig71Ea-PA 100 CG16931-PA 1..97 1..97 327 59.8 Plus
Eig71Ef-PA 98 CG7599-PA 1..96 1..97 182 37.1 Plus
Eig71Ej-PA 98 CG7588-PA 1..97 1..98 163 32.7 Plus
Eig71Eh-PB 101 CG7594-PB 5..95 7..98 161 33.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24985-PA 85 GL24985-PA 16..84 16..82 202 59.4 Plus
Dper\GL25491-PA 98 GL25491-PA 1..96 1..97 169 37.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20285-PA 100 GA20285-PA 1..98 1..98 315 63.3 Plus
Dpse\GA23630-PA 214 GA23630-PA 122..212 10..98 273 58.2 Plus
Dpse\GA20470-PA 98 GA20470-PA 1..96 1..97 174 38.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25550-PA 99 GM25550-PA 1..99 1..99 397 91.9 Plus
Dsec\GM24474-PA 100 GM24474-PA 1..97 1..97 303 56.7 Plus
Dsec\GM24471-PA 98 GM24471-PA 1..96 1..97 164 38.1 Plus
Dsec\GM24470-PA 98 GM24470-PA 1..97 1..98 142 32.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14563-PA 99 GD14563-PA 1..99 1..99 388 87.9 Plus
Dsim\GD12548-PA 100 GD12548-PA 1..80 1..80 263 58.8 Plus
Dsim\GD12545-PA 98 GD12545-PA 1..96 1..97 171 36.1 Plus
Dsim\GD12544-PA 101 GD12544-PA 10..96 12..99 151 34.1 Plus
Dsim\GD12543-PA 98 GD12543-PA 1..97 1..98 142 32.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11358-PA 96 GJ11358-PA 18..91 17..95 141 35.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15124-PA 144 GK15124-PA 1..97 1..97 264 51.5 Plus
Dwil\GK20707-PA 100 GK20707-PA 3..98 6..97 158 36.1 Plus
Dwil\GK20696-PA 102 GK20696-PA 1..97 1..97 151 31.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22265-PA 100 GE22265-PA 1..99 1..99 411 78.8 Plus
Dyak\GE23155-PA 100 GE23155-PA 1..99 1..99 406 77.8 Plus
Dyak\GE19825-PA 100 GE19825-PA 1..97 1..97 313 61.9 Plus
Dyak\GE22833-PA 100 GE22833-PA 1..97 1..97 309 59.8 Plus
Dyak\GE22830-PA 98 GE22830-PA 1..96 1..97 173 38.1 Plus