BDGP Sequence Production Resources |
Search the DGRC for LP04958
Library: | LP |
Tissue Source: | Drosophila melanogaster larval-early pupal |
Created by: | Ling Hong |
Date Registered: | 1998-06-11 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 49 |
Well: | 58 |
Vector: | pOT2 |
Associated Gene/Transcript | RpS10b-RB |
Protein status: | LP04958.pep: gold |
Preliminary Size: | 1108 |
Sequenced Size: | 1020 |
Gene | Date | Evidence |
---|---|---|
CG14206 | 2003-01-01 | Sim4 clustering to Release 3 |
CG14206 | 2003-05-21 | Blastp of sequenced clone |
RpS10b | 2008-04-29 | Release 5.5 accounting |
IM3 | 2008-08-15 | Release 5.9 accounting |
RpS10b | 2008-08-15 | Release 5.9 accounting |
IM3 | 2008-12-18 | 5.12 accounting |
RpS10b | 2008-12-18 | 5.12 accounting |
1020 bp (1020 high quality bases) assembled on 2003-05-21
GenBank Submission: AY070896
> LP04958.complete GGAGTCAAGCTCAGAATTCAACCACAAAAACCAACAACATGAAATTCCTA TCACTCGCCTTCGTTTTGGGTCTGCTGGCTCTGGCCAACGCCACTCCCCT GAATCCTGGCAATGTCATCATCAATGGCGATTGCCGCGTCTGCAATGTGA GGGCCTAAGGGCAGCGGAGAATGAAGGATGCCAGTTGAAGTTCACACAGC CACACATATTTTTAAGTCGAAAATGTAATAGAAATTCCTAGAATCAAGTG CCCATATTAAATATATTCCAAACAAAACAAAAAAAAAAAAAAAAAACCGG GAGTATTACGATACGTTCGCGTTCGTGTAACTTTGTGTTTGCAAATCAAT CCAGAATGTTTATGCCAAAGGCCCATCGTGTCGCGATCTACGAGTACCTC TTCAAGGAGGGCGTGATCGTGGCCAAGAAGGATTTCCATGCCCAGAAGCA CCCGGAACTGGAGTCGATCCCCAACTTGCACGTGATCAAGGCGATGCAGT CGCTCCACTCGCGCGGACTGGTTAAGGAGCAGTTCGCCTGGCGCCACTAC TACTGGTACCTCACCAACGAGGGAATCGAGGAGCTGCGCAGCTACCTCCA CCTGCCGCCCGAGATCGTGCCCTCGACGCTGAAGCGCCCTGCCCGCTCGG AGACCGTCCGTCCCCGTCCCGCCGTTGGCGGCCCACGCGGACCCGGTGAC GCCTCCAAGACCGGAGAGGATCGCTCCGCCTACCGACGTGCTCCCGGCGG CAGCGGAGTGGACAAGAAGGGCGATGTTGGACCCGGTGCCGGAGAGGTCG AGTTCCGTGGCGGATTCGGACGCGGATCGCGCAACTAAACAACCCAGGCG CTTCAGTTTTTTTTTCTAATGTATAAAAAATTACTCAGTAAAATGTTCAA CTGAAGATCCATACCCTTAACAATAGAAGAAACCAACATCTGAAAAATGT GTGTGTGTTTTATGATATGACGATCAATTATAAAGCAAACGCAAGTGAAA AAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 19487242..19487887 | 352..997 | 3230 | 100 | Plus |
chr2R | 21145070 | chr2R | 14275335..14275508 | 90..263 | 855 | 99.4 | Plus |
chr3R | 27901430 | chr3R | 23475751..23476019 | 356..624 | 655 | 82.9 | Plus |
chr2R | 21145070 | chr2R | 14275175..14275264 | 1..90 | 450 | 100 | Plus |
chrX | 22417052 | chrX | 19486961..19487017 | 298..354 | 285 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 19598430..19599078 | 352..1000 | 3245 | 100 | Plus |
2R | 25286936 | 2R | 18388307..18388497 | 90..280 | 955 | 100 | Plus |
3R | 32079331 | 3R | 27652836..27653104 | 356..624 | 640 | 82.5 | Plus |
2R | 25286936 | 2R | 18388147..18388236 | 1..90 | 450 | 100 | Plus |
X | 23542271 | X | 19598149..19598205 | 298..354 | 285 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 19606528..19607176 | 352..1000 | 3245 | 100 | Plus |
2R | 25260384 | 2R | 18389506..18389696 | 90..280 | 955 | 100 | Plus |
2R | 25260384 | 2R | 18389346..18389435 | 1..90 | 450 | 100 | Plus |
3R | 31820162 | 3R | 27393753..27393935 | 442..624 | 420 | 81.9 | Plus |
X | 23527363 | X | 19606247..19606303 | 298..354 | 285 | 100 | Plus |
3R | 31820162 | 3R | 27393667..27393743 | 356..432 | 280 | 90.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\Tv1 | 6868 | Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). | 5936..6036 | 855..959 | 119 | 60 | Plus |
gypsy5 | 7369 | gypsy5 GYPSY5 7369bp | 5462..5543 | 202..285 | 117 | 63.1 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 19486961..19487017 | 298..354 | 100 | -> | Plus |
chrX | 19487245..19487887 | 355..997 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS10b-RC | 1..483 | 356..838 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS10b-RC | 1..483 | 356..838 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS10b-RB | 1..483 | 356..838 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS10b-RC | 1..483 | 356..838 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS10b-RB | 1..483 | 356..838 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS10b-RC | 29..728 | 298..997 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS10b-RC | 29..728 | 298..997 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS10b-RB | 44..743 | 298..997 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS10b-RC | 29..728 | 298..997 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS10b-RB | 44..743 | 298..997 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 19598149..19598205 | 298..354 | 100 | -> | Plus |
X | 19598433..19599075 | 355..997 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 19598149..19598205 | 298..354 | 100 | -> | Plus |
X | 19598433..19599075 | 355..997 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 19598149..19598205 | 298..354 | 100 | -> | Plus |
X | 19598433..19599075 | 355..997 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 19492182..19492238 | 298..354 | 100 | -> | Plus |
arm_X | 19492466..19493108 | 355..997 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 19606531..19607173 | 355..997 | 100 | Plus | |
X | 19606247..19606303 | 298..354 | 100 | -> | Plus |
Translation from 270 to 837
> LP04958.hyp NKTKRKKKNNGSITIRSRSCNFVFANQSRMFMPKAHRVAIYEYLFKEGVI VAKKDFHAQKHPELESIPNLHVIKAMQSLHSRGLVKEQFAWRHYYWYLTN EGIEELRSYLHLPPEIVPSTLKRPARSETVRPRPAVGGPRGPGDASKTGE DRSAYRRAPGGSGVDKKGDVGPGAGEVEFRGGFGRGSRN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS10b-PD | 160 | CG14206-PD | 1..160 | 30..189 | 857 | 100 | Plus |
RpS10b-PC | 160 | CG14206-PC | 1..160 | 30..189 | 857 | 100 | Plus |
RpS10b-PB | 160 | CG14206-PB | 1..160 | 30..189 | 857 | 100 | Plus |
RpS10b-PE | 160 | CG14206-PE | 1..160 | 30..189 | 857 | 100 | Plus |
RpS10a-PA | 163 | CG12275-PA | 1..160 | 30..188 | 611 | 74.4 | Plus |
Translation from 355 to 837
> LP04958.pep MFMPKAHRVAIYEYLFKEGVIVAKKDFHAQKHPELESIPNLHVIKAMQSL HSRGLVKEQFAWRHYYWYLTNEGIEELRSYLHLPPEIVPSTLKRPARSET VRPRPAVGGPRGPGDASKTGEDRSAYRRAPGGSGVDKKGDVGPGAGEVEF RGGFGRGSRN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20407-PA | 160 | GF20407-PA | 1..160 | 1..160 | 828 | 98.8 | Plus |
Dana\GF16988-PA | 187 | GF16988-PA | 1..148 | 1..148 | 655 | 81.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19233-PA | 160 | GG19233-PA | 1..160 | 1..160 | 823 | 98.1 | Plus |
Dere\GG11564-PA | 164 | GG11564-PA | 1..161 | 1..159 | 555 | 72.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24937-PA | 160 | GH24937-PA | 1..160 | 1..160 | 798 | 95 | Plus |
Dgri\GH11289-PA | 164 | GH11289-PA | 1..163 | 1..160 | 370 | 50.6 | Plus |
Dgri\GH10453-PA | 164 | GH10453-PA | 1..163 | 1..160 | 365 | 50 | Plus |
Dgri\GH17537-PA | 278 | GH17537-PA | 1..150 | 1..147 | 316 | 49 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS10b-PE | 160 | CG14206-PE | 1..160 | 1..160 | 857 | 100 | Plus |
RpS10b-PD | 160 | CG14206-PD | 1..160 | 1..160 | 857 | 100 | Plus |
RpS10b-PC | 160 | CG14206-PC | 1..160 | 1..160 | 857 | 100 | Plus |
RpS10b-PB | 160 | CG14206-PB | 1..160 | 1..160 | 857 | 100 | Plus |
RpS10a-PA | 163 | CG12275-PA | 1..160 | 1..159 | 611 | 74.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11113-PA | 160 | GI11113-PA | 1..160 | 1..160 | 808 | 95.6 | Plus |
Dmoj\GI17705-PA | 161 | GI17705-PA | 1..159 | 1..157 | 381 | 52.5 | Plus |
Dmoj\GI24509-PA | 161 | GI24509-PA | 1..151 | 1..149 | 338 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21283-PA | 136 | GL21283-PA | 2..136 | 26..160 | 666 | 94.1 | Plus |
Dper\GL27054-PA | 104 | GL27054-PA | 1..100 | 1..100 | 529 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12822-PA | 160 | GA12822-PA | 1..160 | 1..160 | 823 | 98.1 | Plus |
Dpse\GA24698-PA | 65 | GA24698-PA | 4..48 | 53..95 | 157 | 71.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22969-PA | 160 | GM22969-PA | 1..160 | 1..160 | 834 | 99.4 | Plus |
Dsec\GM16347-PA | 164 | GM16347-PA | 1..161 | 1..159 | 583 | 75.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17450-PA | 160 | GD17450-PA | 1..160 | 1..160 | 834 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15969-PA | 160 | GJ15969-PA | 1..160 | 1..160 | 810 | 96.2 | Plus |
Dvir\GJ16313-PA | 159 | GJ16313-PA | 1..159 | 1..159 | 387 | 51.9 | Plus |
Dvir\GJ11441-PA | 159 | GJ11441-PA | 1..159 | 1..159 | 386 | 51.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25475-PA | 160 | GK25475-PA | 1..160 | 1..160 | 815 | 96.9 | Plus |