Clone LP04958 Report

Search the DGRC for LP04958

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:49
Well:58
Vector:pOT2
Associated Gene/TranscriptRpS10b-RB
Protein status:LP04958.pep: gold
Preliminary Size:1108
Sequenced Size:1020

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14206 2003-01-01 Sim4 clustering to Release 3
CG14206 2003-05-21 Blastp of sequenced clone
RpS10b 2008-04-29 Release 5.5 accounting
IM3 2008-08-15 Release 5.9 accounting
RpS10b 2008-08-15 Release 5.9 accounting
IM3 2008-12-18 5.12 accounting
RpS10b 2008-12-18 5.12 accounting

Clone Sequence Records

LP04958.complete Sequence

1020 bp (1020 high quality bases) assembled on 2003-05-21

GenBank Submission: AY070896

> LP04958.complete
GGAGTCAAGCTCAGAATTCAACCACAAAAACCAACAACATGAAATTCCTA
TCACTCGCCTTCGTTTTGGGTCTGCTGGCTCTGGCCAACGCCACTCCCCT
GAATCCTGGCAATGTCATCATCAATGGCGATTGCCGCGTCTGCAATGTGA
GGGCCTAAGGGCAGCGGAGAATGAAGGATGCCAGTTGAAGTTCACACAGC
CACACATATTTTTAAGTCGAAAATGTAATAGAAATTCCTAGAATCAAGTG
CCCATATTAAATATATTCCAAACAAAACAAAAAAAAAAAAAAAAAACCGG
GAGTATTACGATACGTTCGCGTTCGTGTAACTTTGTGTTTGCAAATCAAT
CCAGAATGTTTATGCCAAAGGCCCATCGTGTCGCGATCTACGAGTACCTC
TTCAAGGAGGGCGTGATCGTGGCCAAGAAGGATTTCCATGCCCAGAAGCA
CCCGGAACTGGAGTCGATCCCCAACTTGCACGTGATCAAGGCGATGCAGT
CGCTCCACTCGCGCGGACTGGTTAAGGAGCAGTTCGCCTGGCGCCACTAC
TACTGGTACCTCACCAACGAGGGAATCGAGGAGCTGCGCAGCTACCTCCA
CCTGCCGCCCGAGATCGTGCCCTCGACGCTGAAGCGCCCTGCCCGCTCGG
AGACCGTCCGTCCCCGTCCCGCCGTTGGCGGCCCACGCGGACCCGGTGAC
GCCTCCAAGACCGGAGAGGATCGCTCCGCCTACCGACGTGCTCCCGGCGG
CAGCGGAGTGGACAAGAAGGGCGATGTTGGACCCGGTGCCGGAGAGGTCG
AGTTCCGTGGCGGATTCGGACGCGGATCGCGCAACTAAACAACCCAGGCG
CTTCAGTTTTTTTTTCTAATGTATAAAAAATTACTCAGTAAAATGTTCAA
CTGAAGATCCATACCCTTAACAATAGAAGAAACCAACATCTGAAAAATGT
GTGTGTGTTTTATGATATGACGATCAATTATAAAGCAAACGCAAGTGAAA
AAAAAAAAAAAAAAAAAAAA

LP04958.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:42:30
Subject Length Description Subject Range Query Range Score Percent Strand
RpS10b.a 1127 RpS10b.a 136..838 298..1000 3515 100 Plus
RpS10b-RB 1260 RpS10b-RB 155..857 298..1000 3515 100 Plus
RpS10b.b 1585 RpS10b.b 155..857 298..1000 3515 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19487242..19487887 352..997 3230 100 Plus
chr2R 21145070 chr2R 14275335..14275508 90..263 855 99.4 Plus
chr3R 27901430 chr3R 23475751..23476019 356..624 655 82.9 Plus
chr2R 21145070 chr2R 14275175..14275264 1..90 450 100 Plus
chrX 22417052 chrX 19486961..19487017 298..354 285 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:49:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19598430..19599078 352..1000 3245 100 Plus
2R 25286936 2R 18388307..18388497 90..280 955 100 Plus
3R 32079331 3R 27652836..27653104 356..624 640 82.5 Plus
2R 25286936 2R 18388147..18388236 1..90 450 100 Plus
X 23542271 X 19598149..19598205 298..354 285 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:03:26
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19606528..19607176 352..1000 3245 100 Plus
2R 25260384 2R 18389506..18389696 90..280 955 100 Plus
2R 25260384 2R 18389346..18389435 1..90 450 100 Plus
3R 31820162 3R 27393753..27393935 442..624 420 81.9 Plus
X 23527363 X 19606247..19606303 298..354 285 100 Plus
3R 31820162 3R 27393667..27393743 356..432 280 90.9 Plus
Blast to na_te.dros performed 2019-03-15 22:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Tv1 6868 Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). 5936..6036 855..959 119 60 Plus
gypsy5 7369 gypsy5 GYPSY5 7369bp 5462..5543 202..285 117 63.1 Plus

LP04958.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:33:52 Download gff for LP04958.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19486961..19487017 298..354 100 -> Plus
chrX 19487245..19487887 355..997 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:43:16 Download gff for LP04958.complete
Subject Subject Range Query Range Percent Splice Strand
RpS10b-RC 1..483 356..838 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:35:38 Download gff for LP04958.complete
Subject Subject Range Query Range Percent Splice Strand
RpS10b-RC 1..483 356..838 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:24:41 Download gff for LP04958.complete
Subject Subject Range Query Range Percent Splice Strand
RpS10b-RB 1..483 356..838 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:11:31 Download gff for LP04958.complete
Subject Subject Range Query Range Percent Splice Strand
RpS10b-RC 1..483 356..838 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:27:44 Download gff for LP04958.complete
Subject Subject Range Query Range Percent Splice Strand
RpS10b-RB 1..483 356..838 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:43:15 Download gff for LP04958.complete
Subject Subject Range Query Range Percent Splice Strand
RpS10b-RC 29..728 298..997 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:35:37 Download gff for LP04958.complete
Subject Subject Range Query Range Percent Splice Strand
RpS10b-RC 29..728 298..997 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:24:41 Download gff for LP04958.complete
Subject Subject Range Query Range Percent Splice Strand
RpS10b-RB 44..743 298..997 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:11:31 Download gff for LP04958.complete
Subject Subject Range Query Range Percent Splice Strand
RpS10b-RC 29..728 298..997 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:27:44 Download gff for LP04958.complete
Subject Subject Range Query Range Percent Splice Strand
RpS10b-RB 44..743 298..997 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:52 Download gff for LP04958.complete
Subject Subject Range Query Range Percent Splice Strand
X 19598149..19598205 298..354 100 -> Plus
X 19598433..19599075 355..997 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:52 Download gff for LP04958.complete
Subject Subject Range Query Range Percent Splice Strand
X 19598149..19598205 298..354 100 -> Plus
X 19598433..19599075 355..997 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:52 Download gff for LP04958.complete
Subject Subject Range Query Range Percent Splice Strand
X 19598149..19598205 298..354 100 -> Plus
X 19598433..19599075 355..997 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:24:41 Download gff for LP04958.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19492182..19492238 298..354 100 -> Plus
arm_X 19492466..19493108 355..997 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:47:56 Download gff for LP04958.complete
Subject Subject Range Query Range Percent Splice Strand
X 19606531..19607173 355..997 100   Plus
X 19606247..19606303 298..354 100 -> Plus

LP04958.hyp Sequence

Translation from 270 to 837

> LP04958.hyp
NKTKRKKKNNGSITIRSRSCNFVFANQSRMFMPKAHRVAIYEYLFKEGVI
VAKKDFHAQKHPELESIPNLHVIKAMQSLHSRGLVKEQFAWRHYYWYLTN
EGIEELRSYLHLPPEIVPSTLKRPARSETVRPRPAVGGPRGPGDASKTGE
DRSAYRRAPGGSGVDKKGDVGPGAGEVEFRGGFGRGSRN*

LP04958.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
RpS10b-PD 160 CG14206-PD 1..160 30..189 857 100 Plus
RpS10b-PC 160 CG14206-PC 1..160 30..189 857 100 Plus
RpS10b-PB 160 CG14206-PB 1..160 30..189 857 100 Plus
RpS10b-PE 160 CG14206-PE 1..160 30..189 857 100 Plus
RpS10a-PA 163 CG12275-PA 1..160 30..188 611 74.4 Plus

LP04958.pep Sequence

Translation from 355 to 837

> LP04958.pep
MFMPKAHRVAIYEYLFKEGVIVAKKDFHAQKHPELESIPNLHVIKAMQSL
HSRGLVKEQFAWRHYYWYLTNEGIEELRSYLHLPPEIVPSTLKRPARSET
VRPRPAVGGPRGPGDASKTGEDRSAYRRAPGGSGVDKKGDVGPGAGEVEF
RGGFGRGSRN*

LP04958.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:57:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20407-PA 160 GF20407-PA 1..160 1..160 828 98.8 Plus
Dana\GF16988-PA 187 GF16988-PA 1..148 1..148 655 81.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:57:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19233-PA 160 GG19233-PA 1..160 1..160 823 98.1 Plus
Dere\GG11564-PA 164 GG11564-PA 1..161 1..159 555 72.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:57:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24937-PA 160 GH24937-PA 1..160 1..160 798 95 Plus
Dgri\GH11289-PA 164 GH11289-PA 1..163 1..160 370 50.6 Plus
Dgri\GH10453-PA 164 GH10453-PA 1..163 1..160 365 50 Plus
Dgri\GH17537-PA 278 GH17537-PA 1..150 1..147 316 49 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:30
Subject Length Description Subject Range Query Range Score Percent Strand
RpS10b-PE 160 CG14206-PE 1..160 1..160 857 100 Plus
RpS10b-PD 160 CG14206-PD 1..160 1..160 857 100 Plus
RpS10b-PC 160 CG14206-PC 1..160 1..160 857 100 Plus
RpS10b-PB 160 CG14206-PB 1..160 1..160 857 100 Plus
RpS10a-PA 163 CG12275-PA 1..160 1..159 611 74.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:57:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11113-PA 160 GI11113-PA 1..160 1..160 808 95.6 Plus
Dmoj\GI17705-PA 161 GI17705-PA 1..159 1..157 381 52.5 Plus
Dmoj\GI24509-PA 161 GI24509-PA 1..151 1..149 338 50 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:57:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21283-PA 136 GL21283-PA 2..136 26..160 666 94.1 Plus
Dper\GL27054-PA 104 GL27054-PA 1..100 1..100 529 99 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:57:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12822-PA 160 GA12822-PA 1..160 1..160 823 98.1 Plus
Dpse\GA24698-PA 65 GA24698-PA 4..48 53..95 157 71.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:57:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22969-PA 160 GM22969-PA 1..160 1..160 834 99.4 Plus
Dsec\GM16347-PA 164 GM16347-PA 1..161 1..159 583 75.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:57:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17450-PA 160 GD17450-PA 1..160 1..160 834 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:57:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15969-PA 160 GJ15969-PA 1..160 1..160 810 96.2 Plus
Dvir\GJ16313-PA 159 GJ16313-PA 1..159 1..159 387 51.9 Plus
Dvir\GJ11441-PA 159 GJ11441-PA 1..159 1..159 386 51.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:57:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25475-PA 160 GK25475-PA 1..160 1..160 815 96.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:57:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15852-PA 160 GE15852-PA 1..160 1..160 831 98.8 Plus
Dyak\GE23749-PA 164 GE23749-PA 1..161 1..159 581 75.2 Plus