Clone LP04985 Report

Search the DGRC for LP04985

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:49
Well:85
Vector:pOT2
Associated Gene/TranscriptmRpL20-RA
Protein status:LP04985.pep: gold
Sequenced Size:591

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
mRpL20 2009-06-08 Manual selection by Joe Carlson

Clone Sequence Records

LP04985.complete Sequence

591 bp assembled on 2009-07-31

GenBank Submission: BT089020.1

> LP04985.complete
TAACAAGTAGAGTCGTTGAGATCAATTAAAAATATATAAAAACTCGACCG
ATATTCTGTTAATATCAAGCCATGGTCTTCCTGAACCTTCCCTTGCTGGT
ACGGTCCCGTGGTCCGGACGAATTCTGGCGGAAGAGACGCATCTTCAAGC
TGGCAGCGCATTATAGAAGCCGCACTCGCAATGTCTACTCCTTCGCCATC
CGGAGTGTCCATAGGGCACTGGCCTATGCCACCAAGGGGCGAAAGCTAAA
GAAACTGGACATGGCGCAACTGTGGAGCACACGCGTGGAGGCGGGTTGTC
AGCAGTATGGAGTAGGTCTGGAAACCTTCAAAGAGGGCCTCGCGCGCTCC
GATATTCTGCTCAACAAAAAAGTCCTATCCGACCTCGCCATTTGGGAGCC
GCGATCTTTTGAAGCTCTAGTAAAGATCTCTCGAGAGCGGGCAGCTGTGG
AGGGAATGCCAGACATCAAACGGAGATCGGCATTTAACCAGGTCTATGGA
CTGAGCAACCTGAAGTTGGATTAACATAGCCTTAAGTAGGAGTTCAAATA
TAGATATTTGTATGTTTTAAAAAAAAAAAAAAAAAAAAAAA

LP04985.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:27:32
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL20-RA 686 mRpL20-RA 83..653 1..571 2855 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13007700..13007909 367..158 1050 100 Minus
chr3L 24539361 chr3L 13007445..13007645 568..368 1005 100 Minus
chr3L 24539361 chr3L 13007972..13008129 158..1 790 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:49:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13017404..13017613 367..158 1050 100 Minus
3L 28110227 3L 13017146..13017349 571..368 1020 100 Minus
3L 28110227 3L 13017676..13017833 158..1 790 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:22:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13010504..13010713 367..158 1050 100 Minus
3L 28103327 3L 13010246..13010449 571..368 1020 100 Minus
3L 28103327 3L 13010776..13010933 158..1 790 100 Minus
Blast to na_te.dros performed on 2019-03-15 17:05:53 has no hits.

LP04985.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:06:40 Download gff for LP04985.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13007972..13008129 1..158 100   Minus
chr3L 13007445..13007645 368..568 100 <- Minus
chr3L 13007700..13007908 159..367 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:12:34 Download gff for LP04985.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL20-RA 1..453 72..524 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:53:49 Download gff for LP04985.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL20-RA 1..453 72..524 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:27:03 Download gff for LP04985.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL20-RA 1..453 72..524 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:25:47 Download gff for LP04985.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL20-RA 1..453 72..524 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-31 13:04:41 Download gff for LP04985.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL20-RA 1..568 1..568 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:53:48 Download gff for LP04985.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL20-RA 1..568 1..568 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:27:03 Download gff for LP04985.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL20-RA 35..602 1..568 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:25:47 Download gff for LP04985.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL20-RA 35..602 1..568 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:06:40 Download gff for LP04985.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13017149..13017349 368..568 100 <- Minus
3L 13017404..13017612 159..367 100 <- Minus
3L 13017676..13017833 1..158 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:06:40 Download gff for LP04985.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13017149..13017349 368..568 100 <- Minus
3L 13017404..13017612 159..367 100 <- Minus
3L 13017676..13017833 1..158 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:06:40 Download gff for LP04985.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13017149..13017349 368..568 100 <- Minus
3L 13017404..13017612 159..367 100 <- Minus
3L 13017676..13017833 1..158 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:27:03 Download gff for LP04985.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13010249..13010449 368..568 100 <- Minus
arm_3L 13010504..13010712 159..367 100 <- Minus
arm_3L 13010776..13010933 1..158 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:44:35 Download gff for LP04985.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13010249..13010449 368..568 100 <- Minus
3L 13010504..13010712 159..367 100 <- Minus
3L 13010776..13010933 1..158 100   Minus

LP04985.pep Sequence

Translation from 71 to 523

> LP04985.pep
MVFLNLPLLVRSRGPDEFWRKRRIFKLAAHYRSRTRNVYSFAIRSVHRAL
AYATKGRKLKKLDMAQLWSTRVEAGCQQYGVGLETFKEGLARSDILLNKK
VLSDLAIWEPRSFEALVKISRERAAVEGMPDIKRRSAFNQVYGLSNLKLD
*

LP04985.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25175-PA 150 GF25175-PA 1..150 1..150 752 94.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13788-PA 150 GG13788-PA 1..150 1..150 780 99.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14480-PA 150 GH14480-PA 1..150 1..150 746 93.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:24
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL20-PA 150 CG11258-PA 1..150 1..150 762 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13635-PA 150 GI13635-PA 1..150 1..150 739 92 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24871-PA 150 GL24871-PA 1..150 1..150 749 93.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10871-PA 150 GA10871-PA 1..150 1..150 749 93.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24614-PA 150 GM24614-PA 1..150 1..150 784 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12681-PA 150 GD12681-PA 1..150 1..150 783 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13973-PA 150 GJ13973-PA 1..150 1..150 747 92.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16834-PA 150 GK16834-PA 1..150 1..150 729 90 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20081-PA 150 GE20081-PA 1..150 1..150 775 98 Plus

LP04985.hyp Sequence

Translation from 71 to 523

> LP04985.hyp
MVFLNLPLLVRSRGPDEFWRKRRIFKLAAHYRSRTRNVYSFAIRSVHRAL
AYATKGRKLKKLDMAQLWSTRVEAGCQQYGVGLETFKEGLARSDILLNKK
VLSDLAIWEPRSFEALVKISRERAAVEGMPDIKRRSAFNQVYGLSNLKLD
*

LP04985.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL20-PA 150 CG11258-PA 1..150 1..150 762 100 Plus