Clone LP05143 Report

Search the DGRC for LP05143

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:51
Well:43
Vector:pOT2
Associated Gene/TranscriptCG9822-RA
Protein status:LP05143.pep: gold
Preliminary Size:797
Sequenced Size:870

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9822 2002-01-01 Sim4 clustering to Release 2
CG9822 2002-05-18 Blastp of sequenced clone
CG9822 2003-01-01 Sim4 clustering to Release 3
CG9822 2008-04-29 Release 5.5 accounting
CG9822 2008-08-15 Release 5.9 accounting
CG9822 2008-12-18 5.12 accounting

Clone Sequence Records

LP05143.complete Sequence

870 bp (870 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119025

> LP05143.complete
TGAACATGGAGTACGGTAGATTTCAAACGGTCGGTTGTCTGTTGATCATC
CTGGGTATGGCCAGTTCTCAGCCCCTGTCCTGGTGTGATCCGGACTTATG
TCCTGACAACACGGTGCACATAGCGTGTAATAACGATGGTAAATTCCATG
AAAGCTGCTCCCCGGATGCCACTATGGTGGACCTGAAGCCTTATCGCAAA
CTTATCGTGAATGAGCACAACAAGCGCAGGAACTACATTGCCTCTGGATC
TTTGCCCGGCTACTATCCGGCCACCCGCATGGCCACCATGGTGTGGGATG
AGGAGCTGGAGTACCTGGCCACGTTGAACCTGAAAACCTGTTACCTGGAG
CACGACGACTGCCACAACAGCTACCGCTTCCGGAATCTGGGTCAGAATCT
CTGCGGTGTCGATCGTCGGAGGAACTGGGACTTGAACGTGACCAATCTGG
TGGAGCAGTCGATGGGCTTGTGGTTTGGAGAGCACAAACTCATCGACAGC
AGTTACATTACCGATTTTAAGCTGACCAAAGACCTCGAAAAGTATGGACA
CTTTGTGGAAACCGTGCTGGACAGGAACACCCATGTGGGCTGTGCCATGA
TGCGCTTCACCAATCCGCAGTACCCCTTCCTCTACATCTACAATACTGCC
TGCAACTATGCCAGTGTCTATGCCATCGGAGTTCCTGTTTACAATGCCGG
AAAGCCCGCCTCTGAATGCCGGACGGGAAGTAATCCAGAGTATCCCGCAC
TCTGTTCCATCAAGGAACAATACAATCCAAACCACAATTTCTACTAGCTA
ATCAACCAAATGATAAATACGCAACCAAAATACACTATAGTTAATGAACC
TAAAAAAAAAAAAAAAAAAA

LP05143.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG9822-RA 1064 CG9822-RA 136..988 1..853 4265 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17233717..17234111 535..141 1930 99.2 Minus
chr2R 21145070 chr2R 17233332..17233646 851..537 1545 99.4 Minus
chr2R 21145070 chr2R 17234170..17234308 139..1 665 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:49:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:16:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21347260..21347654 535..141 1975 100 Minus
2R 25286936 2R 21346873..21347190 853..536 1590 100 Minus
2R 25286936 2R 21347712..21347851 140..1 700 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:33:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21348459..21348853 535..141 1975 100 Minus
2R 25260384 2R 21348072..21348389 853..536 1590 100 Minus
2R 25260384 2R 21348911..21349050 140..1 700 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:16:18 has no hits.

LP05143.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:17:08 Download gff for LP05143.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17233332..17233647 536..851 99 <- Minus
chr2R 17233717..17234111 141..535 99 <- Minus
chr2R 17234169..17234308 1..140 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:36:15 Download gff for LP05143.complete
Subject Subject Range Query Range Percent Splice Strand
CG9822-RA 1..792 6..797 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:43:00 Download gff for LP05143.complete
Subject Subject Range Query Range Percent Splice Strand
CG9822-RA 1..792 6..797 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:12:23 Download gff for LP05143.complete
Subject Subject Range Query Range Percent Splice Strand
CG9822-RA 1..792 6..797 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:35:10 Download gff for LP05143.complete
Subject Subject Range Query Range Percent Splice Strand
CG9822-RA 1..792 6..797 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:36:30 Download gff for LP05143.complete
Subject Subject Range Query Range Percent Splice Strand
CG9822-RA 1..792 6..797 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:17:23 Download gff for LP05143.complete
Subject Subject Range Query Range Percent Splice Strand
CG9822-RA 1..851 1..851 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:42:59 Download gff for LP05143.complete
Subject Subject Range Query Range Percent Splice Strand
CG9822-RA 1..851 1..851 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:12:23 Download gff for LP05143.complete
Subject Subject Range Query Range Percent Splice Strand
CG9822-RA 33..883 1..851 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:35:10 Download gff for LP05143.complete
Subject Subject Range Query Range Percent Splice Strand
CG9822-RA 1..797 1..797 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:36:30 Download gff for LP05143.complete
Subject Subject Range Query Range Percent Splice Strand
CG9822-RA 33..883 1..851 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:17:08 Download gff for LP05143.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21346875..21347190 536..851 100 <- Minus
2R 21347260..21347654 141..535 100 <- Minus
2R 21347712..21347851 1..140 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:17:08 Download gff for LP05143.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21346875..21347190 536..851 100 <- Minus
2R 21347260..21347654 141..535 100 <- Minus
2R 21347712..21347851 1..140 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:17:08 Download gff for LP05143.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21346875..21347190 536..851 100 <- Minus
2R 21347260..21347654 141..535 100 <- Minus
2R 21347712..21347851 1..140 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:12:23 Download gff for LP05143.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17234380..17234695 536..851 100 <- Minus
arm_2R 17234765..17235159 141..535 100 <- Minus
arm_2R 17235217..17235356 1..140 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:07:29 Download gff for LP05143.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21348074..21348389 536..851 100 <- Minus
2R 21348459..21348853 141..535 100 <- Minus
2R 21348911..21349050 1..140 100   Minus

LP05143.hyp Sequence

Translation from 2 to 796

> LP05143.hyp
NMEYGRFQTVGCLLIILGMASSQPLSWCDPDLCPDNTVHIACNNDGKFHE
SCSPDATMVDLKPYRKLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDE
ELEYLATLNLKTCYLEHDDCHNSYRFRNLGQNLCGVDRRRNWDLNVTNLV
EQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGCAMM
RFTNPQYPFLYIYNTACNYASVYAIGVPVYNAGKPASECRTGSNPEYPAL
CSIKEQYNPNHNFY*

LP05143.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:03:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG9822-PA 263 CG9822-PA 1..263 2..264 1464 100 Plus
CG17974-PA 259 CG17974-PA 13..258 15..260 799 56.1 Plus
CG32679-PA 254 CG32679-PA 14..250 13..260 436 40.6 Plus
CG6628-PA 277 CG6628-PA 24..260 20..257 435 41.1 Plus
Ag5r-PC 256 CG9538-PC 4..256 7..264 419 36.9 Plus

LP05143.pep Sequence

Translation from 5 to 796

> LP05143.pep
MEYGRFQTVGCLLIILGMASSQPLSWCDPDLCPDNTVHIACNNDGKFHES
CSPDATMVDLKPYRKLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEE
LEYLATLNLKTCYLEHDDCHNSYRFRNLGQNLCGVDRRRNWDLNVTNLVE
QSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGCAMMR
FTNPQYPFLYIYNTACNYASVYAIGVPVYNAGKPASECRTGSNPEYPALC
SIKEQYNPNHNFY*

LP05143.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:52:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12100-PA 263 GF12100-PA 1..263 1..263 1254 85.6 Plus
Dana\GF12099-PA 263 GF12099-PA 12..262 9..259 794 55.8 Plus
Dana\GF20496-PA 256 GF20496-PA 13..254 12..260 437 38.4 Plus
Dana\GF21595-PA 256 GF21595-PA 11..255 13..257 423 39.8 Plus
Dana\GF12004-PA 289 GF12004-PA 20..281 22..257 396 36.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:52:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20782-PA 263 GG20782-PA 1..263 1..263 1358 93.5 Plus
Dere\GG20780-PA 261 GG20780-PA 15..260 14..259 770 54.9 Plus
Dere\GG18928-PA 253 GG18928-PA 11..250 12..260 430 38.5 Plus
Dere\GG13982-PA 277 GG13982-PA 24..260 19..256 410 39.3 Plus
Dere\GG19449-PA 256 GG19449-PA 4..253 6..260 406 37.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:52:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21186-PA 270 GH21186-PA 18..267 13..263 988 69.7 Plus
Dgri\GH21184-PA 264 GH21184-PA 16..264 13..260 835 57.8 Plus
Dgri\GH12878-PA 260 GH12878-PA 30..257 26..260 427 37.9 Plus
Dgri\GH17451-PA 253 GH17451-PA 3..252 8..257 414 37.1 Plus
Dgri\GH12214-PA 256 GH12214-PA 6..256 8..263 406 37.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG9822-PA 263 CG9822-PA 1..263 1..263 1464 100 Plus
CG17974-PA 259 CG17974-PA 13..258 14..259 799 56.1 Plus
CG32679-PA 254 CG32679-PA 14..250 12..259 436 40.6 Plus
CG6628-PA 277 CG6628-PA 24..260 19..256 435 41.1 Plus
Ag5r-PC 256 CG9538-PC 4..256 6..263 419 36.9 Plus
Ag5r-PB 256 CG9538-PB 4..256 6..263 419 36.9 Plus
Ag5r-PA 256 CG9538-PA 4..256 6..263 419 36.9 Plus
CG17575-PA 291 CG17575-PA 12..286 12..260 393 34.9 Plus
Ag5r2-PA 254 CG9540-PA 8..252 13..259 378 34.7 Plus
CG17575-PB 298 CG17575-PB 12..293 12..260 376 34.7 Plus
scpr-A-PA 264 CG5207-PA 3..253 6..257 366 34 Plus
scpr-B-PA 262 CG17210-PA 3..251 9..257 361 33.9 Plus
scpr-C-PB 262 CG5106-PB 9..251 12..257 356 35.5 Plus
scpr-C-PA 262 CG5106-PA 9..251 12..257 356 35.5 Plus
CG42564-PA 500 CG10284-PA 45..283 17..256 356 32.5 Plus
CG42780-PA 253 CG42780-PA 21..251 25..251 351 35.9 Plus
CG3640-PA 296 CG3640-PA 11..253 13..259 345 33.2 Plus
CG42780-PB 254 CG42780-PB 21..252 25..251 342 35.7 Plus
CG9400-PA 308 CG9400-PA 69..288 38..257 319 32.9 Plus
CG30486-PA 263 CG30486-PA 8..255 12..259 308 32.4 Plus
CG34002-PB 350 CG34002-PB 27..255 25..254 244 28.1 Plus
CG31296-PB 280 CG31296-PB 11..254 12..259 236 29.4 Plus
CG31296-PA 280 CG31296-PA 11..254 12..259 236 29.4 Plus
CG10651-PB 316 CG10651-PB 23..247 26..250 178 27.8 Plus
CG10651-PA 316 CG10651-PA 23..247 26..250 178 27.8 Plus
antr-PB 272 CG30488-PB 25..254 27..259 175 25.3 Plus
CG8072-PA 247 CG8072-PA 3..240 5..250 172 28.5 Plus
CG43777-PA 273 CG43777-PA 49..266 43..259 167 25.1 Plus
CG43777-PC 273 CG43777-PC 49..266 43..259 167 25.1 Plus
CG43777-PB 273 CG43777-PB 49..266 43..259 167 25.1 Plus
CG43776-PA 270 CG43776-PA 34..259 35..250 164 27.8 Plus
CG43776-PB 270 CG43776-PB 34..259 35..250 164 27.8 Plus
CG8483-PA 392 CG8483-PA 37..214 64..251 153 29 Plus
antr-PA 265 CG30488-PA 25..247 27..259 152 24.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20472-PA 267 GI20472-PA 28..267 24..263 1006 74.6 Plus
Dmoj\GI20471-PA 263 GI20471-PA 16..263 13..260 861 58.9 Plus
Dmoj\GI15745-PA 257 GI15745-PA 12..253 14..260 428 41.8 Plus
Dmoj\GI15744-PA 256 GI15744-PA 8..255 13..257 402 37.3 Plus
Dmoj\GI20220-PA 283 GI20220-PA 24..273 24..257 382 36 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11847-PA 263 GL11847-PA 1..261 1..263 1153 79.1 Plus
Dper\GL11846-PA 261 GL11846-PA 7..260 7..259 779 54.3 Plus
Dper\GL20409-PA 257 GL20409-PA 9..257 11..263 411 37.8 Plus
Dper\GL17456-PA 291 GL17456-PA 22..280 21..257 387 35.4 Plus
Dper\GL20410-PA 254 GL20410-PA 17..252 22..259 363 35.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22059-PA 263 GA22059-PA 1..261 1..263 1153 79.1 Plus
Dpse\GA14749-PA 261 GA14749-PA 7..260 7..259 784 54.7 Plus
Dpse\GA23354-PA 263 GA23354-PA 19..260 12..260 465 40.2 Plus
Dpse\GA29233-PA 258 GA29233-PA 9..257 6..257 419 37.7 Plus
Dpse\GA28431-PA 253 GA28431-PA 4..250 5..255 412 37.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15726-PA 263 GM15726-PA 1..263 1..263 1409 97.7 Plus
Dsec\GM15725-PA 258 GM15725-PA 12..257 14..259 777 55.7 Plus
Dsec\GM11319-PA 237 GM11319-PA 8..234 25..260 427 40.2 Plus
Dsec\GM24819-PA 277 GM24819-PA 24..260 19..256 420 39.4 Plus
Dsec\GM12039-PA 256 GM12039-PA 4..253 6..260 408 37.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25203-PA 263 GD25203-PA 1..263 1..263 1414 98.1 Plus
Dsim\GD25202-PA 258 GD25202-PA 7..257 9..259 785 55.4 Plus
Dsim\GD16039-PA 254 GD16039-PA 13..251 13..260 435 39 Plus
Dsim\GD12870-PA 277 GD12870-PA 24..261 19..257 424 39.7 Plus
Dsim\GD25810-PA 291 GD25810-PA 23..283 24..257 389 35 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22322-PA 262 GJ22322-PA 11..262 11..263 1041 72.7 Plus
Dvir\GJ22321-PA 263 GJ22321-PA 16..263 13..260 862 58.5 Plus
Dvir\GJ18605-PA 253 GJ18605-PA 2..252 12..257 412 37.7 Plus
Dvir\GJ18606-PA 256 GJ18606-PA 6..253 8..260 409 38 Plus
Dvir\GJ18491-PA 324 GJ18491-PA 92..320 26..259 398 37.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20747-PA 259 GK20747-PA 6..255 7..254 1067 76.4 Plus
Dwil\GK20746-PA 265 GK20746-PA 14..265 11..261 779 55.2 Plus
Dwil\GK18435-PA 257 GK18435-PA 22..256 22..257 456 40.7 Plus
Dwil\GK25699-PA 253 GK25699-PA 15..250 18..260 455 42.1 Plus
Dwil\GK18446-PA 263 GK18446-PA 15..263 13..263 410 37 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13719-PA 263 GE13719-PA 1..263 1..263 1372 94.3 Plus
Dyak\GE13718-PA 262 GE13718-PA 16..261 14..259 772 54.9 Plus
Dyak\GE15398-PA 253 GE15398-PA 11..250 12..260 445 40.1 Plus
Dyak\Ag5r-PA 256 GE16102-PA 4..256 6..263 408 36.5 Plus
Dyak\GE20280-PA 277 GE20280-PA 24..261 19..257 392 36 Plus