BDGP Sequence Production Resources |
Search the DGRC for LP05252
Library: | LP |
Tissue Source: | Drosophila melanogaster larval-early pupal |
Created by: | Ling Hong |
Date Registered: | 1998-06-11 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 52 |
Well: | 52 |
Vector: | pOT2 |
Associated Gene/Transcript | CG4151-RA |
Protein status: | LP05252.pep: gold |
Preliminary Size: | 727 |
Sequenced Size: | 764 |
Gene | Date | Evidence |
---|---|---|
CG4151 | 2002-01-01 | Sim4 clustering to Release 2 |
CG4151 | 2002-05-18 | Blastp of sequenced clone |
CG4151 | 2003-01-01 | Sim4 clustering to Release 3 |
CG4151 | 2008-04-29 | Release 5.5 accounting |
CG4151 | 2008-08-15 | Release 5.9 accounting |
CG4151 | 2008-12-18 | 5.12 accounting |
764 bp (764 high quality bases) assembled on 2002-05-18
GenBank Submission: AY119026
> LP05252.complete CAGTTGACAGCAGCAAAGATCTCCAGATCCACCAGAGAAATCATGAGCAA GTTCACCATTTGCCTTCTCCTCGTCGTCCTGGCCATCGTGGCCATCCAGG CTGATGGCGATCGGCGTCCGTGTGTGGGTCGCTGCACCGGTCTGTCCAGC GGCCAGAGTGTGTGCATCCGCAACAAGGTGACCAATGTGTGCACCCGCCT GCCGGCCTGTCGTCTGCGGGAGAAGAATTGCCGCCGTCGGGACAATGGAC TCGAACCCATTCGGGAGACATGCATCACCCGCTGTCGCAACATTCCCGGC ACCAGCGGCGTGGGCCAGTGCGCCATCAGGCTGCGTCCTCGTCCCCAGTC CGATGGCAAGCGCATCAAGGAGTGCCAGAGGAGGATCTGCCTTGACGACA AGCTGGCCAGCTGCTGGAGGGACCAGCAGGGCGCTTGCATCCTGCAGACC CGCTGCGAGGCCCAGAGGAGGAACTGCGTCCGGAATCCGCTTAACCAGTG GGTGAGGGCCAGCCAGTGGAGCTGCCAGGGCAATGTTGTGGGCGGTGGCA TCCGACGCTGCCGCACCAGGCCCATCATCATCAAGGACTAAGAGTTCTGG CGAGGAAGCCCCCATACGCGGATCCCAACTTGAATCCTGGCACTGACCTC CTTTCGCATACAGTTTTTTTTTGTCCAACTTCTTTAAATTTTTTTGCCTA TGTTAGTCCCGTACAAATATAAATAATTCAATCACATTTAAAAAAAAAAA AAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 5394253..5394991 | 1..739 | 3695 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 5501832..5502573 | 1..742 | 3710 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 5509930..5510671 | 1..742 | 3710 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 5394253..5394991 | 1..739 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4151-RA | 1..549 | 43..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4151-RA | 1..549 | 43..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4151-RA | 1..549 | 43..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4151-RA | 1..549 | 43..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4151-RA | 1..549 | 43..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4151-RA | 1..739 | 1..739 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4151-RA | 1..739 | 1..739 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4151-RA | 1..739 | 1..739 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4151-RA | 1..739 | 1..739 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4151-RA | 20..758 | 1..739 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 5501832..5502570 | 1..739 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 5501832..5502570 | 1..739 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 5501832..5502570 | 1..739 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 5395865..5396603 | 1..739 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 5509930..5510668 | 1..739 | 100 | Plus |
Translation from 0 to 590
> LP05252.hyp QLTAAKISRSTREIMSKFTICLLLVVLAIVAIQADGDRRPCVGRCTGLSS GQSVCIRNKVTNVCTRLPACRLREKNCRRRDNGLEPIRETCITRCRNIPG TSGVGQCAIRLRPRPQSDGKRIKECQRRICLDDKLASCWRDQQGACILQT RCEAQRRNCVRNPLNQWVRASQWSCQGNVVGGGIRRCRTRPIIIKD*
Translation from 42 to 590
> LP05252.pep MSKFTICLLLVVLAIVAIQADGDRRPCVGRCTGLSSGQSVCIRNKVTNVC TRLPACRLREKNCRRRDNGLEPIRETCITRCRNIPGTSGVGQCAIRLRPR PQSDGKRIKECQRRICLDDKLASCWRDQQGACILQTRCEAQRRNCVRNPL NQWVRASQWSCQGNVVGGGIRRCRTRPIIIKD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21087-PA | 184 | GF21087-PA | 1..184 | 1..182 | 619 | 68.6 | Plus |
Dana\GF22014-PA | 105 | GF22014-PA | 1..97 | 1..96 | 161 | 43.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18766-PA | 182 | GG18766-PA | 1..182 | 1..182 | 826 | 89 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11865-PA | 175 | GH11865-PA | 1..167 | 1..162 | 228 | 37.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG4151-PB | 182 | CG4151-PB | 1..182 | 1..182 | 990 | 100 | Plus |
CG4151-PA | 182 | CG4151-PA | 1..182 | 1..182 | 990 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI15651-PA | 170 | GI15651-PA | 1..163 | 1..162 | 268 | 40.8 | Plus |
Dmoj\GI14960-PA | 170 | GI14960-PA | 1..163 | 1..162 | 268 | 40.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16441-PA | 185 | GL16441-PA | 1..185 | 1..182 | 533 | 66.3 | Plus |
Dper\GL16458-PA | 188 | GL16458-PA | 15..188 | 14..182 | 494 | 60.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA17989-PA | 185 | GA17989-PA | 1..185 | 1..182 | 523 | 64.7 | Plus |
Dpse\GA22585-PA | 188 | GA22585-PA | 1..187 | 1..181 | 505 | 60.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12416-PA | 182 | GM12416-PA | 1..182 | 1..182 | 879 | 96.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD16735-PA | 156 | GD16735-PA | 57..156 | 83..182 | 481 | 93 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19234-PA | 179 | GJ19234-PA | 2..172 | 1..163 | 218 | 36.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19839-PA | 189 | GK19839-PA | 1..189 | 1..182 | 518 | 60 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE16409-PA | 183 | GE16409-PA | 1..183 | 1..182 | 864 | 93.4 | Plus |