Clone LP05252 Report

Search the DGRC for LP05252

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:52
Well:52
Vector:pOT2
Associated Gene/TranscriptCG4151-RA
Protein status:LP05252.pep: gold
Preliminary Size:727
Sequenced Size:764

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4151 2002-01-01 Sim4 clustering to Release 2
CG4151 2002-05-18 Blastp of sequenced clone
CG4151 2003-01-01 Sim4 clustering to Release 3
CG4151 2008-04-29 Release 5.5 accounting
CG4151 2008-08-15 Release 5.9 accounting
CG4151 2008-12-18 5.12 accounting

Clone Sequence Records

LP05252.complete Sequence

764 bp (764 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119026

> LP05252.complete
CAGTTGACAGCAGCAAAGATCTCCAGATCCACCAGAGAAATCATGAGCAA
GTTCACCATTTGCCTTCTCCTCGTCGTCCTGGCCATCGTGGCCATCCAGG
CTGATGGCGATCGGCGTCCGTGTGTGGGTCGCTGCACCGGTCTGTCCAGC
GGCCAGAGTGTGTGCATCCGCAACAAGGTGACCAATGTGTGCACCCGCCT
GCCGGCCTGTCGTCTGCGGGAGAAGAATTGCCGCCGTCGGGACAATGGAC
TCGAACCCATTCGGGAGACATGCATCACCCGCTGTCGCAACATTCCCGGC
ACCAGCGGCGTGGGCCAGTGCGCCATCAGGCTGCGTCCTCGTCCCCAGTC
CGATGGCAAGCGCATCAAGGAGTGCCAGAGGAGGATCTGCCTTGACGACA
AGCTGGCCAGCTGCTGGAGGGACCAGCAGGGCGCTTGCATCCTGCAGACC
CGCTGCGAGGCCCAGAGGAGGAACTGCGTCCGGAATCCGCTTAACCAGTG
GGTGAGGGCCAGCCAGTGGAGCTGCCAGGGCAATGTTGTGGGCGGTGGCA
TCCGACGCTGCCGCACCAGGCCCATCATCATCAAGGACTAAGAGTTCTGG
CGAGGAAGCCCCCATACGCGGATCCCAACTTGAATCCTGGCACTGACCTC
CTTTCGCATACAGTTTTTTTTTGTCCAACTTCTTTAAATTTTTTTGCCTA
TGTTAGTCCCGTACAAATATAAATAATTCAATCACATTTAAAAAAAAAAA
AAAAAAAAAAAAAA

LP05252.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG4151-RA 744 CG4151-RA 1..742 1..742 3710 100 Plus
nc_22033.a 602 nc_22033.a 1..537 742..206 2685 100 Minus
nc_22033.a 602 nc_22033.a 535..602 71..4 340 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:34:57
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 5394253..5394991 1..739 3695 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:49:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:34:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 5501832..5502573 1..742 3710 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:33:51
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 5509930..5510671 1..742 3710 100 Plus
Blast to na_te.dros performed on 2019-03-16 04:34:56 has no hits.

LP05252.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:35:48 Download gff for LP05252.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 5394253..5394991 1..739 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:36:25 Download gff for LP05252.complete
Subject Subject Range Query Range Percent Splice Strand
CG4151-RA 1..549 43..591 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:43:01 Download gff for LP05252.complete
Subject Subject Range Query Range Percent Splice Strand
CG4151-RA 1..549 43..591 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:35:01 Download gff for LP05252.complete
Subject Subject Range Query Range Percent Splice Strand
CG4151-RA 1..549 43..591 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:35:11 Download gff for LP05252.complete
Subject Subject Range Query Range Percent Splice Strand
CG4151-RA 1..549 43..591 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:44:37 Download gff for LP05252.complete
Subject Subject Range Query Range Percent Splice Strand
CG4151-RA 1..549 43..591 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:17:25 Download gff for LP05252.complete
Subject Subject Range Query Range Percent Splice Strand
CG4151-RA 1..739 1..739 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:43:01 Download gff for LP05252.complete
Subject Subject Range Query Range Percent Splice Strand
CG4151-RA 1..739 1..739 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:35:01 Download gff for LP05252.complete
Subject Subject Range Query Range Percent Splice Strand
CG4151-RA 1..739 1..739 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:35:11 Download gff for LP05252.complete
Subject Subject Range Query Range Percent Splice Strand
CG4151-RA 1..739 1..739 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:44:37 Download gff for LP05252.complete
Subject Subject Range Query Range Percent Splice Strand
CG4151-RA 20..758 1..739 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:35:48 Download gff for LP05252.complete
Subject Subject Range Query Range Percent Splice Strand
X 5501832..5502570 1..739 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:35:48 Download gff for LP05252.complete
Subject Subject Range Query Range Percent Splice Strand
X 5501832..5502570 1..739 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:35:48 Download gff for LP05252.complete
Subject Subject Range Query Range Percent Splice Strand
X 5501832..5502570 1..739 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:35:01 Download gff for LP05252.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5395865..5396603 1..739 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:07:31 Download gff for LP05252.complete
Subject Subject Range Query Range Percent Splice Strand
X 5509930..5510668 1..739 100   Plus

LP05252.hyp Sequence

Translation from 0 to 590

> LP05252.hyp
QLTAAKISRSTREIMSKFTICLLLVVLAIVAIQADGDRRPCVGRCTGLSS
GQSVCIRNKVTNVCTRLPACRLREKNCRRRDNGLEPIRETCITRCRNIPG
TSGVGQCAIRLRPRPQSDGKRIKECQRRICLDDKLASCWRDQQGACILQT
RCEAQRRNCVRNPLNQWVRASQWSCQGNVVGGGIRRCRTRPIIIKD*

LP05252.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG4151-PB 182 CG4151-PB 1..182 15..196 990 100 Plus
CG4151-PA 182 CG4151-PA 1..182 15..196 990 100 Plus

LP05252.pep Sequence

Translation from 42 to 590

> LP05252.pep
MSKFTICLLLVVLAIVAIQADGDRRPCVGRCTGLSSGQSVCIRNKVTNVC
TRLPACRLREKNCRRRDNGLEPIRETCITRCRNIPGTSGVGQCAIRLRPR
PQSDGKRIKECQRRICLDDKLASCWRDQQGACILQTRCEAQRRNCVRNPL
NQWVRASQWSCQGNVVGGGIRRCRTRPIIIKD*

LP05252.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:52:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21087-PA 184 GF21087-PA 1..184 1..182 619 68.6 Plus
Dana\GF22014-PA 105 GF22014-PA 1..97 1..96 161 43.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:52:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18766-PA 182 GG18766-PA 1..182 1..182 826 89 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:52:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11865-PA 175 GH11865-PA 1..167 1..162 228 37.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG4151-PB 182 CG4151-PB 1..182 1..182 990 100 Plus
CG4151-PA 182 CG4151-PA 1..182 1..182 990 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:52:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15651-PA 170 GI15651-PA 1..163 1..162 268 40.8 Plus
Dmoj\GI14960-PA 170 GI14960-PA 1..163 1..162 268 40.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:52:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16441-PA 185 GL16441-PA 1..185 1..182 533 66.3 Plus
Dper\GL16458-PA 188 GL16458-PA 15..188 14..182 494 60.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:52:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17989-PA 185 GA17989-PA 1..185 1..182 523 64.7 Plus
Dpse\GA22585-PA 188 GA22585-PA 1..187 1..181 505 60.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12416-PA 182 GM12416-PA 1..182 1..182 879 96.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16735-PA 156 GD16735-PA 57..156 83..182 481 93 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:52:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19234-PA 179 GJ19234-PA 2..172 1..163 218 36.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:52:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19839-PA 189 GK19839-PA 1..189 1..182 518 60 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:52:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16409-PA 183 GE16409-PA 1..183 1..182 864 93.4 Plus