Clone LP05579 Report

Search the DGRC for LP05579

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:55
Well:79
Vector:pOT2
Associated Gene/Transcriptppl-RA
Protein status:LP05579.pep: gold
Preliminary Size:1031
Sequenced Size:916

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7758 2001-01-01 Release 2 assignment
CG7758 2002-01-03 Blastp of sequenced clone
CG7758 2003-01-01 Sim4 clustering to Release 3
ppl 2008-04-29 Release 5.5 accounting
ppl 2008-08-15 Release 5.9 accounting
ppl 2008-12-18 5.12 accounting

Clone Sequence Records

LP05579.complete Sequence

916 bp (916 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075433

> LP05579.complete
TTTACTCGGGTCAACAAAAGTTCACGAATTATATTCTGGATTGTGATAAG
CCGGGCAATATTCGACTTTCATCCCGATTGCCGGGCATTAAACGTAGCGT
GTGTGTTTTCAAATCGGATCACTTGTCACCGAAACACCCCCGGGAACGGT
TGGAAAATTCATCTCGCCGGCAGTTGCCTTTGTTTTTGACTGGGAAAATA
TGGTATTCATAACGAAATTCGCAAGGATTGGGCTGCAGGCCGCCCGCCAG
CTTAGTGTCACGCCCCTTGGCGCCGTCCAGGCTCGCGCCATTCACCTGAC
AAGCCTTCTAGCCAAAGAACGCCGATACACAAACAAACACGAGTGGGTGG
AGGTGGTATCCGGCAGCAATGCCATAGTAGGCATCTCCAGCTACGCCCAG
GAGGCTCTCGGGGATGTGGTGTTCGCCCAACTCCCAGAACCCGGCACGGA
ACTCAAGCAGGATGACGAATGTGGGGCCCTGGAGAGCGTTAAAGCGGCTA
GCGAGGTGTATTCACCCGTTAGTGGCAAGGTAATTGAAAAGAATGCCGAG
GTGGAGGACACACCGGCCCTAGTCAACAGCAGTTGCTATGAGAAGGGCTG
GCTTTTCAAGGTGGACCTGAAGAATCCCAAGGAACTCGAAGCCCTTATGA
CCGAGGATCAGTACAAAGCCTTCCTGAGCAGCAGTGGGGATCACTAGAAC
CAGCAGCTAATCCTAACCCTAAAGCATCTTGACTGTAGCCTTTAAAACGA
GTAATTGTTAGCATTTGTTATCAGCTGAATAACGCTACACTCATACCCAA
ATATCACCAACCAAACTCATCGCCATACACACGTTGTTGTAGCTCTTGAA
ATTTGTTACGAATAAGAATCAACAATAAATCCAAATGTTATATTTAAAAA
AAAAAAAAAAAAAAAA

LP05579.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:32:08
Subject Length Description Subject Range Query Range Score Percent Strand
ppl-RA 1107 ppl-RA 118..1015 1..898 4490 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21270193..21270509 317..1 1585 100 Minus
chr3L 24539361 chr3L 21269499..21269798 895..596 1500 100 Minus
chr3L 24539361 chr3L 21269858..21270139 597..316 1410 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:50:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21281185..21281501 317..1 1585 100 Minus
3L 28110227 3L 21280488..21280790 898..596 1515 100 Minus
3L 28110227 3L 21280850..21281131 597..316 1410 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:00:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21274285..21274601 317..1 1585 100 Minus
3L 28103327 3L 21273588..21273890 898..596 1515 100 Minus
3L 28103327 3L 21273950..21274231 597..316 1410 100 Minus
Blast to na_te.dros performed on 2019-03-16 11:37:41 has no hits.

LP05579.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:38:56 Download gff for LP05579.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21269499..21269797 597..895 100 <- Minus
chr3L 21269859..21270137 318..596 100 <- Minus
chr3L 21270193..21270509 1..317 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:36:41 Download gff for LP05579.complete
Subject Subject Range Query Range Percent Splice Strand
ppl-RA 1..498 200..697 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:52:58 Download gff for LP05579.complete
Subject Subject Range Query Range Percent Splice Strand
ppl-RA 1..498 200..697 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:04:42 Download gff for LP05579.complete
Subject Subject Range Query Range Percent Splice Strand
ppl-RA 1..498 200..697 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:18:33 Download gff for LP05579.complete
Subject Subject Range Query Range Percent Splice Strand
ppl-RA 1..498 200..697 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:22:00 Download gff for LP05579.complete
Subject Subject Range Query Range Percent Splice Strand
ppl-RA 1..498 200..697 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:16:29 Download gff for LP05579.complete
Subject Subject Range Query Range Percent Splice Strand
ppl-RA 1..895 1..895 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:52:57 Download gff for LP05579.complete
Subject Subject Range Query Range Percent Splice Strand
ppl-RA 1..895 1..895 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:04:42 Download gff for LP05579.complete
Subject Subject Range Query Range Percent Splice Strand
ppl-RA 6..900 1..895 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:18:33 Download gff for LP05579.complete
Subject Subject Range Query Range Percent Splice Strand
ppl-RA 1..895 1..895 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:22:00 Download gff for LP05579.complete
Subject Subject Range Query Range Percent Splice Strand
ppl-RA 6..900 1..895 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:38:56 Download gff for LP05579.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21280491..21280789 597..895 100 <- Minus
3L 21280851..21281129 318..596 100 <- Minus
3L 21281185..21281501 1..317 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:38:56 Download gff for LP05579.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21280491..21280789 597..895 100 <- Minus
3L 21280851..21281129 318..596 100 <- Minus
3L 21281185..21281501 1..317 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:38:56 Download gff for LP05579.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21280491..21280789 597..895 100 <- Minus
3L 21280851..21281129 318..596 100 <- Minus
3L 21281185..21281501 1..317 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:04:42 Download gff for LP05579.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21273591..21273889 597..895 100 <- Minus
arm_3L 21273951..21274229 318..596 100 <- Minus
arm_3L 21274285..21274601 1..317 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:52:47 Download gff for LP05579.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21273591..21273889 597..895 100 <- Minus
3L 21273951..21274229 318..596 100 <- Minus
3L 21274285..21274601 1..317 100   Minus

LP05579.hyp Sequence

Translation from 199 to 696

> LP05579.hyp
MVFITKFARIGLQAARQLSVTPLGAVQARAIHLTSLLAKERRYTNKHEWV
EVVSGSNAIVGISSYAQEALGDVVFAQLPEPGTELKQDDECGALESVKAA
SEVYSPVSGKVIEKNAEVEDTPALVNSSCYEKGWLFKVDLKNPKELEALM
TEDQYKAFLSSSGDH*

LP05579.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
ppl-PA 165 CG7758-PA 1..165 1..165 832 100 Plus

LP05579.pep Sequence

Translation from 199 to 696

> LP05579.pep
MVFITKFARIGLQAARQLSVTPLGAVQARAIHLTSLLAKERRYTNKHEWV
EVVSGSNAIVGISSYAQEALGDVVFAQLPEPGTELKQDDECGALESVKAA
SEVYSPVSGKVIEKNAEVEDTPALVNSSCYEKGWLFKVDLKNPKELEALM
TEDQYKAFLSSSGDH*

LP05579.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:20:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10174-PA 165 GF10174-PA 1..165 1..165 740 83.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:20:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13249-PA 165 GG13249-PA 1..165 1..165 840 96.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:20:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16517-PA 165 GH16517-PA 1..165 1..165 713 79.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
ppl-PA 165 CG7758-PA 1..165 1..165 832 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:20:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12199-PA 165 GI12199-PA 1..165 1..165 669 73.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:20:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24593-PA 165 GL24593-PA 1..165 1..165 721 80.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:20:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20566-PA 165 GA20566-PA 1..165 1..165 722 80.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:20:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22153-PA 165 GM22153-PA 1..165 1..165 848 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:20:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12129-PA 165 GD12129-PA 1..165 1..165 863 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:20:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11431-PA 165 GJ11431-PA 1..165 1..165 739 81.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:20:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20396-PA 168 GK20396-PA 1..168 1..165 694 78 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:20:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22960-PA 165 GE22960-PA 1..165 1..165 844 97 Plus
Dyak\GE22349-PA 165 GE22349-PA 1..165 1..165 842 96.4 Plus