Clone LP05614 Report

Search the DGRC for LP05614

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:56
Well:14
Vector:pOT2
Associated Gene/TranscriptCyt-c-d-RA
Protein status:LP05614.pep: gold
Preliminary Size:976
Sequenced Size:879

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13263 2001-01-01 Release 2 assignment
CG13263 2003-01-01 Sim4 clustering to Release 3
CG13263 2003-03-19 Blastp of sequenced clone
Cyt-c-d 2008-04-29 Release 5.5 accounting
Cyt-c-d 2008-08-15 Release 5.9 accounting
Cyt-c-d 2008-12-18 5.12 accounting

Clone Sequence Records

LP05614.complete Sequence

879 bp (879 high quality bases) assembled on 2003-03-19

GenBank Submission: BT006002

> LP05614.complete
GAACACATAACTTTCGAAGGTGACAAGCAGCAAACAAATTTTCCGTTCTC
GCCGAGTCTTGTTGTTTTGGGGATATTTTCCAACTCAAAAACTGGTGCGT
TTCAGTTCCTTTACAGACGCAAGACGCGTAATATTCGATCGGTGTAACGG
TGAACAGAATCGGCAGCGGGAAAACCGAACGCGGCGAACTCAGCTGATTG
AATGAAAACGCCAAGCTGAGCAGCAGCCACAATTGCCATTGCCCCAACCA
GCGCTCATTGAGAGAGGGAGCCAACGAGAGAGCGAGCAACAAGCAACTGC
AGAGCGAGAAGAACTGTCCGTCGGGCTTCCAAGATGGGTTCTGGTGATGC
AGAGAACGGCAAGAAGATATTTGTGCAGAAGTGCGCCCAGTGCCACACCT
ACGAAGTGGGCGGCAAACACAAGGTGGGCCCAAATCTTGGCGGGGTCGTG
GGTCGCAAGTGTGGCACAGCAGCGGGATACAAGTATACCGATGCCAATAT
AAAGAAGGGCGTTACCTGGACAGAGGGGAATTTGGACGAGTACCTCAAGG
ACCCGAAGAAATACATTCCCGGAACAAAGATGGTGTTCGCAGGTCTTAAA
AAGGCTGAGGAGCGGGCCGATTTGATTGCCTTCCTCAAGTCAAACAAGTA
GAATCGCCTGCGAAACAACAAGATCGGCCACCATGCTATCCAGAAAACTG
CGCTTAAAGACTACAAACATATTCAAAAGATGACGTATTTCACTTGGATT
TCGAAACTTTGATTGGGAATGGTCGAGCTCAAATACATTTCAAAAAGGTT
TACTTTCACTTTAGCCAATTAAAGTTGATAAACCAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LP05614.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
Cyt-c-d-RA 1104 Cyt-c-d-RA 78..916 1..839 4195 100 Plus
Cyt-c-d.b 941 Cyt-c-d.b 68..803 104..839 3680 100 Plus
Cyt-c-d.a 905 Cyt-c-d.a 34..767 106..839 3670 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:37:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16717854..16718367 324..834 2490 99.4 Plus
chr2L 23010047 chr2L 16714597..16714921 1..325 1625 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 19:50:19
Subject Length Description Subject Range Query Range Score Percent Strand
CR31808-RA 1830 CR31808-RA 1..203 203..1 1015 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16719125..16719640 324..839 2580 100 Plus
2L 23513712 2L 16715894..16716218 1..325 1625 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:48:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16719125..16719640 324..839 2580 100 Plus
2L 23513712 2L 16715894..16716218 1..325 1625 100 Plus
2L 23513712 2L 16722063..16722159 341..437 170 78.3 Plus
Blast to na_te.dros performed on 2019-03-16 11:37:47 has no hits.

LP05614.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:38:59 Download gff for LP05614.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16714597..16714920 1..324 100 -> Plus
chr2L 16717855..16718367 325..834 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:36:42 Download gff for LP05614.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-d-RA 1..318 334..651 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:11:38 Download gff for LP05614.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-d-RA 1..318 334..651 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:05:20 Download gff for LP05614.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-d-RA 1..318 334..651 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:42:42 Download gff for LP05614.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-d-RA 1..318 334..651 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:22:06 Download gff for LP05614.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-d-RA 1..318 334..651 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 19:50:20 Download gff for LP05614.complete
Subject Subject Range Query Range Percent Splice Strand
CR31808-RA 1..203 1..203 100   Minus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:03:22 Download gff for LP05614.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-d-RA 37..870 1..834 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:11:37 Download gff for LP05614.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-d-RA 37..870 1..834 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:05:20 Download gff for LP05614.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-d-RA 4..837 1..834 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:42:42 Download gff for LP05614.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-d-RA 37..870 1..834 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:22:06 Download gff for LP05614.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-d-RA 4..837 1..834 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:38:59 Download gff for LP05614.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16715894..16716217 1..324 100 -> Plus
2L 16719126..16719635 325..834 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:38:59 Download gff for LP05614.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16715894..16716217 1..324 100 -> Plus
2L 16719126..16719635 325..834 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:38:59 Download gff for LP05614.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16715894..16716217 1..324 100 -> Plus
2L 16719126..16719635 325..834 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:05:20 Download gff for LP05614.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16715894..16716217 1..324 100 -> Plus
arm_2L 16719126..16719635 325..834 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:20:19 Download gff for LP05614.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16715894..16716217 1..324 100 -> Plus
2L 16719126..16719635 325..834 100   Plus

LP05614.pep Sequence

Translation from 333 to 650

> LP05614.pep
MGSGDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYK
YTDANIKKGVTWTEGNLDEYLKDPKKYIPGTKMVFAGLKKAEERADLIAF
LKSNK*

LP05614.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:39:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20842-PA 104 GF20842-PA 1..104 1..105 496 91.4 Plus
Dana\GF20853-PA 108 GF20853-PA 5..105 3..103 396 72.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22762-PA 105 GG22762-PA 1..105 1..105 524 93.3 Plus
Dere\GG22763-PA 108 GG22763-PA 5..105 3..103 396 72.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11375-PA 103 GH11375-PA 1..103 1..105 465 86.7 Plus
Dgri\GH11376-PA 108 GH11376-PA 5..105 3..103 402 73.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:45
Subject Length Description Subject Range Query Range Score Percent Strand
Cyt-c-d-PB 105 CG13263-PB 1..105 1..105 565 100 Plus
Cyt-c-d-PA 105 CG13263-PA 1..105 1..105 565 100 Plus
Cyt-c-p-PB 108 CG17903-PB 5..105 3..103 407 72.3 Plus
Cyt-c-p-PA 108 CG17903-PA 5..105 3..103 407 72.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18080-PA 104 GI18080-PA 1..104 1..105 484 86.7 Plus
Dmoj\GI18081-PA 108 GI18081-PA 5..105 3..103 388 70.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18777-PA 105 GL18777-PA 1..105 1..105 460 81.9 Plus
Dper\GL18778-PA 116 GL18778-PA 5..98 3..96 359 69.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12159-PA 105 GA12159-PA 1..105 1..105 460 81.9 Plus
Dpse\GA14714-PA 108 GA14714-PA 5..105 3..103 396 72.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17196-PA 105 GM17196-PA 1..105 1..105 546 100 Plus
Dsec\GM17197-PA 108 GM17197-PA 5..105 3..103 396 72.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24072-PA 105 GD24072-PA 1..105 1..105 546 100 Plus
Dsim\GD24074-PA 108 GD24074-PA 5..105 3..103 396 72.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:39:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16711-PA 104 GJ16711-PA 1..104 1..105 481 87.6 Plus
Dvir\GJ16722-PA 108 GJ16722-PA 5..105 3..103 392 71.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:39:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18205-PA 105 GK18205-PA 1..105 1..105 485 86.7 Plus
Dwil\GK15007-PA 108 GK15007-PA 5..105 3..103 396 72.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:39:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12756-PA 105 GE12756-PA 1..105 1..105 538 97.1 Plus
Dyak\GE12757-PA 108 GE12757-PA 5..105 3..103 396 72.3 Plus

LP05614.hyp Sequence

Translation from 333 to 650

> LP05614.hyp
MGSGDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYK
YTDANIKKGVTWTEGNLDEYLKDPKKYIPGTKMVFAGLKKAEERADLIAF
LKSNK*

LP05614.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:30:47
Subject Length Description Subject Range Query Range Score Percent Strand
Cyt-c-d-PB 105 CG13263-PB 1..105 1..105 565 100 Plus
Cyt-c-d-PA 105 CG13263-PA 1..105 1..105 565 100 Plus
Cyt-c-p-PB 108 CG17903-PB 5..105 3..103 407 72.3 Plus
Cyt-c-p-PA 108 CG17903-PA 5..105 3..103 407 72.3 Plus