Clone LP05669 Report

Search the DGRC for LP05669

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:56
Well:69
Vector:pOT2
Associated Gene/TranscriptCG34226-RA
Protein status:LP05669.pep: Inserted from web
Preliminary Size:540
Sequenced Size:415

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18337 2002-01-01 Sim4 clustering to Release 2
CG30029 2003-01-01 Sim4 clustering to Release 3
CG34226 2008-04-29 Release 5.5 accounting
CG34226 2008-08-15 Release 5.9 accounting
CG34226 2008-12-18 5.12 accounting

Clone Sequence Records

LP05669.complete Sequence

415 bp (415 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119030.1

> LP05669.complete
CAAAGATCCAAGCACAACCGAAGAAATCTCTCCACGAAATCACTGACCCG
AAGTATCTGCAAGATGCGTCTAATCCTTCTGTCCATCGTTGGCCTCCTGT
GTCTGGCCTATGCCCTCGCCCTGAATGAGAATGCAGCTGCTCTCGAGGAT
CTGGTCAATCTAGGAGCAGAACATGCCGAAAGCGGAGTGCGAGATGCTCG
TGGTTAAGGTCATGGCAACTACGGACATGGCAACTACGGACATGGCAACT
ACGGACATGGTCATCACGGGGGTGGTGGTCATGGACATGGACATTATGGT
CGCTAGTGTATTTATACATTTTTAAACTAACCCTGATGACAACACATATA
TTTCAAATACAATTTATTAAAATAAAGTAGGTTCTCTTCAAACTGCAAAA
AAAAAAAAAAAAAAA

LP05669.complete Blast Records

Blast to MB8.fasta performed on 2010-07-15 20:54:54 has no hits.
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7133582..7133977 1..396 1965 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 19:50:23
Subject Length Description Subject Range Query Range Score Percent Strand
CR30029-RA 540 CR30029-RA 3..400 1..398 1990 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:44:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11246119..11246516 1..398 1990 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11247318..11247715 1..398 1990 100 Plus
Blast to na_te.dros performed 2019-03-16 11:44:14
Subject Length Description Subject Range Query Range Score Percent Strand
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 1148..1183 342..377 108 77.8 Plus

LP05669.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:44:57 Download gff for LP05669.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7133582..7133977 1..396 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:36:46 Download gff for LP05669.complete
Subject Subject Range Query Range Percent Splice Strand
CG34226-RA 1..144 64..207 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:34:43 Download gff for LP05669.complete
Subject Subject Range Query Range Percent Splice Strand
CG34226-RA 1..144 64..207 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 19:50:23 Download gff for LP05669.complete
Subject Subject Range Query Range Percent Splice Strand
CR30029-RA 3..398 1..396 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-27 15:32:41 Download gff for LP05669.complete
Subject Subject Range Query Range Percent Splice Strand
CG34226-RA 1..396 1..396 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:34:44 Download gff for LP05669.complete
Subject Subject Range Query Range Percent Splice Strand
CG34226-RA 1..396 1..396 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:44:57 Download gff for LP05669.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11246119..11246514 1..396 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:44:57 Download gff for LP05669.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11246119..11246514 1..396 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:44:57 Download gff for LP05669.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11246119..11246514 1..396 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:01:26 Download gff for LP05669.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7133624..7134019 1..396 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:01:26 Download gff for LP05669.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7133624..7134019 1..396 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:01:26 Download gff for LP05669.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7133624..7134019 1..396 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:16:40 Download gff for LP05669.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11247318..11247713 1..396 100   Plus

LP05669.pep Sequence

Translation from 0 to 206

> LP05669.pep
QRSKHNRRNLSTKSLTRSICKMRLILLSIVGLLCLAYALALNENAAALED
LVNLGAEHAESGVRDARG*

LP05669.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:28:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20176-PA 91 GG20176-PA 1..47 22..67 175 80.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:28:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21265-PA 80 GM21265-PA 1..46 22..67 134 87 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10778-PA 80 GD10778-PA 1..46 22..67 136 89.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:28:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12865-PA 85 GE12865-PA 1..46 22..67 174 80.4 Plus

LP05669.hyp Sequence

Translation from 0 to 206

> LP05669.hyp
QRSKHNRRNLSTKSLTRSICKMRLILLSIVGLLCLAYALALNENAAALED
LVNLGAEHAESGVRDARG*
Sequence LP05669.hyp has no blast hits.