Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
LP05669.complete Sequence
415 bp (415 high quality bases) assembled on 2002-05-18
GenBank Submission: AY119030.1
> LP05669.complete
CAAAGATCCAAGCACAACCGAAGAAATCTCTCCACGAAATCACTGACCCG
AAGTATCTGCAAGATGCGTCTAATCCTTCTGTCCATCGTTGGCCTCCTGT
GTCTGGCCTATGCCCTCGCCCTGAATGAGAATGCAGCTGCTCTCGAGGAT
CTGGTCAATCTAGGAGCAGAACATGCCGAAAGCGGAGTGCGAGATGCTCG
TGGTTAAGGTCATGGCAACTACGGACATGGCAACTACGGACATGGCAACT
ACGGACATGGTCATCACGGGGGTGGTGGTCATGGACATGGACATTATGGT
CGCTAGTGTATTTATACATTTTTAAACTAACCCTGATGACAACACATATA
TTTCAAATACAATTTATTAAAATAAAGTAGGTTCTCTTCAAACTGCAAAA
AAAAAAAAAAAAAAA
LP05669.complete Blast Records
Blast to MB8.fasta performed on 2010-07-15 20:54:54 has no hits.
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:44:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 7133582..7133977 | 1..396 | 1965 | 99.7 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 19:50:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CR30029-RA | 540 | CR30029-RA | 3..400 | 1..398 | 1990 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:44:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 11246119..11246516 | 1..398 | 1990 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 11247318..11247715 | 1..398 | 1990 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 11:44:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ZAM | 8435 | ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). | 1148..1183 | 342..377 | 108 | 77.8 | Plus |
LP05669.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:44:57 Download gff for
LP05669.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 7133582..7133977 | 1..396 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:36:46 Download gff for
LP05669.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34226-RA | 1..144 | 64..207 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:34:43 Download gff for
LP05669.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34226-RA | 1..144 | 64..207 | 100 | | Plus |
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 19:50:23 Download gff for
LP05669.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CR30029-RA | 3..398 | 1..396 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-27 15:32:41 Download gff for
LP05669.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34226-RA | 1..396 | 1..396 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:34:44 Download gff for
LP05669.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34226-RA | 1..396 | 1..396 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:44:57 Download gff for
LP05669.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11246119..11246514 | 1..396 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:44:57 Download gff for
LP05669.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11246119..11246514 | 1..396 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:44:57 Download gff for
LP05669.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11246119..11246514 | 1..396 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:01:26 Download gff for
LP05669.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 7133624..7134019 | 1..396 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:01:26 Download gff for
LP05669.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 7133624..7134019 | 1..396 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:01:26 Download gff for
LP05669.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 7133624..7134019 | 1..396 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:16:40 Download gff for
LP05669.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11247318..11247713 | 1..396 | 100 | | Plus |
LP05669.pep Sequence
Translation from 0 to 206
> LP05669.pep
QRSKHNRRNLSTKSLTRSICKMRLILLSIVGLLCLAYALALNENAAALED
LVNLGAEHAESGVRDARG*
LP05669.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:28:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG20176-PA | 91 | GG20176-PA | 1..47 | 22..67 | 175 | 80.9 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:28:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM21265-PA | 80 | GM21265-PA | 1..46 | 22..67 | 134 | 87 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:28:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD10778-PA | 80 | GD10778-PA | 1..46 | 22..67 | 136 | 89.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:28:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE12865-PA | 85 | GE12865-PA | 1..46 | 22..67 | 174 | 80.4 | Plus |
LP05669.hyp Sequence
Translation from 0 to 206
> LP05669.hyp
QRSKHNRRNLSTKSLTRSICKMRLILLSIVGLLCLAYALALNENAAALED
LVNLGAEHAESGVRDARG*
Sequence LP05669.hyp has no blast hits.