Clone LP05733 Report

Search the DGRC for LP05733

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:57
Well:33
Vector:pOT2
Associated Gene/TranscriptCG7953-RA
Protein status:LP05733.pep: gold
Preliminary Size:1215
Sequenced Size:1098

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7953 2001-01-01 Release 2 assignment
CG7953 2003-01-01 Sim4 clustering to Release 3
CG7953 2003-01-13 Blastp of sequenced clone
CG7953 2008-04-29 Release 5.5 accounting
CG7953 2008-08-15 Release 5.9 accounting
CG7953 2008-12-18 5.12 accounting

Clone Sequence Records

LP05733.complete Sequence

1098 bp (1098 high quality bases) assembled on 2003-01-13

GenBank Submission: AY069738

> LP05733.complete
CTAAAAGTCACAATCAAGCATGCGTTTCCTGGTAGTCTTAGCCTGCCTGG
TGGCCGTTTGTGCCGCCGGCACTCTGCCCAACGAGGTGGAGCAGCGTCTG
TTGGAGCTGGCGGATCAGAATGGTGACATCGATCTGGTCGCGGAGCCCCA
GGAGGGAGTTGAAGTTGCCCCCCAGTTTATTGTGTCCTGGCAGGCGCGTC
GCTTCATCCGCAAGCTCCAGAAGCAGATGGAGTGCGGATGGCCCCAGTAT
GGCATTCCCGTGCTGGCTCCTCTTCGCATCAACGAATTCGACCTAGACTA
CAAAAAGGGCATTTTCGAGACCTTGAACCATGTGTTCCGCCTGAAGATCG
CCGGTCTGAATGACTTCAATATCCAGAAGTTCAAGCTGAACGTGATCACC
AGCAAGATTACCTTCGATTTTCTGTTCAAGAACATCGATACCACCGCCCA
GAAGTACGACACTGATACGCTGATCGATGCCCTGCGCCAGTTGGGTCTGT
CCGTGGAGTACGAGGGATCCGGAGAGCTGTTGTTCGATTTGGTCAACCTG
CGTATTGCTGGCACTCTGAAGTACAAGCTTCCCATGCTGTGGGGTTCCGC
CAAGATCACCTCGCTGAAGACCACCATCTCGTTGGAGTCTGTGACTTCGG
ACATCACTGGATTCATGGGCAACGGCAAGATCAACCGCGCCATCAACAGC
CAGCTGGAGAACATCGTGGTAAAGGGAATCAATGGCAACCAGGACGCCAT
TTCCGAGACCATTGAGAACGCCATCGTGCCGCGAGTGAACAAGATGCTGA
AGGGCAAGGACTTCTGGACCGTCGTGGACCTGATCCTGGCCAGCAGCGAC
GGTGAGAGCGAGGACGATCCGATTGTCGTTGATTGCGATCCCTCCGCCGA
TCCCTGGGCCTAAACTATGGGACAGCCGTGAATAAACACTTGTCGATATA
TTCAATTATTGGTCTACTTTTGGGGTTTTTATTTGTGGAATCCCATTGGA
CTCTCATTTCCTGCTCCAATATCCACAATCAATCTATAATTATATGCTCT
GAATTCACTGAATGTGGTTTGCCTAACCAAAAAAAAAAAAAAAAAAAA

LP05733.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:27:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG7953-RA 1171 CG7953-RA 48..1132 1..1085 5395 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13846980..13847893 163..1076 4570 100 Plus
chr2L 23010047 chr2L 13846673..13846836 1..164 820 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:50:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:00:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13848250..13849172 163..1085 4585 99.8 Plus
2L 23513712 2L 13847943..13848106 1..164 820 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13848250..13849172 163..1085 4585 99.7 Plus
2L 23513712 2L 13847943..13848106 1..164 820 100 Plus
Blast to na_te.dros performed 2019-03-15 20:00:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_M 2935 Dbif\P-element_M P_M 2935bp Derived from X60990. 1518..1551 113..77 115 83.8 Minus

LP05733.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:01:24 Download gff for LP05733.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13846673..13846836 1..164 100 -> Plus
chr2L 13846982..13847895 165..1078 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:36:51 Download gff for LP05733.complete
Subject Subject Range Query Range Percent Splice Strand
CG7953-RA 1..894 20..913 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:58:09 Download gff for LP05733.complete
Subject Subject Range Query Range Percent Splice Strand
CG7953-RA 1..894 20..913 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:04:48 Download gff for LP05733.complete
Subject Subject Range Query Range Percent Splice Strand
CG7953-RA 1..894 20..913 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:48:59 Download gff for LP05733.complete
Subject Subject Range Query Range Percent Splice Strand
CG7953-RA 1..894 20..913 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:12:33 Download gff for LP05733.complete
Subject Subject Range Query Range Percent Splice Strand
CG7953-RA 1..894 20..913 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:14:37 Download gff for LP05733.complete
Subject Subject Range Query Range Percent Splice Strand
CG7953-RA 1..1078 1..1078 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:58:09 Download gff for LP05733.complete
Subject Subject Range Query Range Percent Splice Strand
CG7953-RA 4..1081 1..1078 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:04:48 Download gff for LP05733.complete
Subject Subject Range Query Range Percent Splice Strand
CG7953-RB 19..1096 1..1078 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:48:59 Download gff for LP05733.complete
Subject Subject Range Query Range Percent Splice Strand
CG7953-RA 1..1078 1..1078 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:12:33 Download gff for LP05733.complete
Subject Subject Range Query Range Percent Splice Strand
CG7953-RB 19..1096 1..1078 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:01:24 Download gff for LP05733.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13847943..13848106 1..164 100 -> Plus
2L 13848252..13849165 165..1078 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:01:24 Download gff for LP05733.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13847943..13848106 1..164 100 -> Plus
2L 13848252..13849165 165..1078 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:01:24 Download gff for LP05733.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13847943..13848106 1..164 100 -> Plus
2L 13848252..13849165 165..1078 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:04:48 Download gff for LP05733.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13847943..13848106 1..164 100 -> Plus
arm_2L 13848252..13849165 165..1078 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:20:23 Download gff for LP05733.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13848252..13849165 165..1078 99   Plus
2L 13847943..13848106 1..164 100 -> Plus

LP05733.pep Sequence

Translation from 19 to 912

> LP05733.pep
MRFLVVLACLVAVCAAGTLPNEVEQRLLELADQNGDIDLVAEPQEGVEVA
PQFIVSWQARRFIRKLQKQMECGWPQYGIPVLAPLRINEFDLDYKKGIFE
TLNHVFRLKIAGLNDFNIQKFKLNVITSKITFDFLFKNIDTTAQKYDTDT
LIDALRQLGLSVEYEGSGELLFDLVNLRIAGTLKYKLPMLWGSAKITSLK
TTISLESVTSDITGFMGNGKINRAINSQLENIVVKGINGNQDAISETIEN
AIVPRVNKMLKGKDFWTVVDLILASSDGESEDDPIVVDCDPSADPWA*

LP05733.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14265-PA 296 GF14265-PA 1..296 1..297 1425 90.9 Plus
Dana\GF14264-PA 287 GF14264-PA 19..278 36..296 515 40.7 Plus
Dana\GF15613-PA 259 GF15613-PA 1..229 1..260 348 33.5 Plus
Dana\GF14266-PA 250 GF14266-PA 25..249 58..285 192 25.4 Plus
Dana\GF15614-PA 242 GF15614-PA 54..239 78..272 180 27.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23892-PA 297 GG23892-PA 1..297 1..297 1481 93.6 Plus
Dere\GG23891-PA 287 GG23891-PA 8..278 3..296 448 34.9 Plus
Dere\GG10175-PA 261 GG10175-PA 36..229 63..260 348 37.4 Plus
Dere\GG23893-PA 250 GG23893-PA 25..249 58..285 223 27.2 Plus
Dere\GG10176-PA 244 GG10176-PA 21..240 40..272 175 24.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11122-PA 301 GH11122-PA 1..301 1..297 1234 76.4 Plus
Dgri\GH11121-PA 278 GH11121-PA 8..278 3..296 460 37.3 Plus
Dgri\GH10611-PA 258 GH10611-PA 28..230 55..261 361 37.8 Plus
Dgri\GH10612-PA 250 GH10612-PA 40..230 63..260 226 29 Plus
Dgri\GH11123-PA 245 GH11123-PA 26..244 58..285 180 24 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG7953-PB 297 CG7953-PB 1..297 1..297 1521 100 Plus
CG7953-PA 297 CG7953-PA 1..297 1..297 1521 100 Plus
CG7916-PA 287 CG7916-PA 19..278 36..296 434 36.3 Plus
CG8997-PB 260 CG8997-PB 36..260 63..296 356 34.5 Plus
CG8997-PA 260 CG8997-PA 36..260 63..296 356 34.5 Plus
CG7968-PA 250 CG7968-PA 25..249 58..285 221 27.2 Plus
CG33306-PA 244 CG33306-PA 17..240 45..272 187 24.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12604-PA 298 GI12604-PA 1..298 1..297 1155 72.2 Plus
Dmoj\GI12593-PA 282 GI12593-PA 5..278 4..296 457 35.7 Plus
Dmoj\GI17402-PA 256 GI17402-PA 28..251 55..287 360 36.2 Plus
Dmoj\GI17403-PA 245 GI17403-PA 17..245 45..275 208 26.4 Plus
Dmoj\GI12614-PA 249 GI12614-PA 28..237 60..274 204 26.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21241-PA 297 GL21241-PA 1..297 1..297 1391 87.2 Plus
Dper\GL21240-PA 287 GL21240-PA 4..278 3..296 493 37.2 Plus
Dper\GL21075-PA 258 GL21075-PA 28..238 55..272 338 34.9 Plus
Dper\GL21242-PA 250 GL21242-PA 25..249 58..285 209 25.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20716-PA 297 GA20716-PA 1..297 1..297 1397 87.5 Plus
Dpse\GA20684-PA 287 GA20684-PA 4..278 3..296 493 37.2 Plus
Dpse\GA21464-PA 258 GA21464-PA 28..238 55..272 339 34.9 Plus
Dpse\GA20729-PA 250 GA20729-PA 25..249 58..285 208 25.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15320-PA 297 GM15320-PA 1..297 1..297 1515 96.3 Plus
Dsec\GM15309-PA 261 GM15309-PA 45..232 54..240 375 39.9 Plus
Dsec\GM15045-PA 258 GM15045-PA 20..229 46..260 351 35.8 Plus
Dsec\GM15330-PA 250 GM15330-PA 25..250 58..286 223 26.6 Plus
Dsec\GM15048-PA 242 GM15048-PA 1..238 1..272 178 22.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23933-PA 289 GD23933-PA 1..289 1..297 1459 93.6 Plus
Dsim\GD23932-PA 287 GD23932-PA 45..278 54..296 453 37.7 Plus
Dsim\GD23934-PA 250 GD23934-PA 25..250 58..286 224 27.1 Plus
Dsim\GD22033-PA 244 GD22033-PA 21..240 40..272 174 23.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18152-PA 301 GJ18152-PA 1..301 1..297 1225 73.8 Plus
Dvir\GJ18151-PA 282 GJ18151-PA 4..278 3..296 443 33.2 Plus
Dvir\GJ18080-PA 256 GJ18080-PA 28..247 55..281 355 36.7 Plus
Dvir\GJ18153-PA 251 GJ18153-PA 28..251 60..286 230 27.3 Plus
Dvir\GJ18083-PA 247 GJ18083-PA 46..246 69..276 215 28.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15016-PA 298 GK15016-PA 1..298 1..297 1317 82.3 Plus
Dwil\GK15013-PA 287 GK15013-PA 19..278 36..296 485 38.1 Plus
Dwil\GK15116-PA 258 GK15116-PA 1..230 1..261 351 32.6 Plus
Dwil\GK15017-PA 253 GK15017-PA 28..253 58..286 252 29.3 Plus
Dwil\GK15117-PA 242 GK15117-PA 16..239 45..272 177 23.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18691-PA 297 GE18691-PA 1..297 1..297 1514 96 Plus
Dyak\GE18690-PA 287 GE18690-PA 19..278 36..296 464 37.8 Plus
Dyak\GE11368-PA 259 GE11368-PA 35..229 62..260 341 36.7 Plus
Dyak\GE18692-PA 250 GE18692-PA 25..249 58..285 217 26.8 Plus
Dyak\GE11373-PA 244 GE11373-PA 47..240 70..272 176 23.2 Plus

LP05733.hyp Sequence

Translation from 19 to 912

> LP05733.hyp
MRFLVVLACLVAVCAAGTLPNEVEQRLLELADQNGDIDLVAEPQEGVEVA
PQFIVSWQARRFIRKLQKQMECGWPQYGIPVLAPLRINEFDLDYKKGIFE
TLNHVFRLKIAGLNDFNIQKFKLNVITSKITFDFLFKNIDTTAQKYDTDT
LIDALRQLGLSVEYEGSGELLFDLVNLRIAGTLKYKLPMLWGSAKITSLK
TTISLESVTSDITGFMGNGKINRAINSQLENIVVKGINGNQDAISETIEN
AIVPRVNKMLKGKDFWTVVDLILASSDGESEDDPIVVDCDPSADPWA*

LP05733.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:04:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG7953-PB 297 CG7953-PB 1..297 1..297 1521 100 Plus
CG7953-PA 297 CG7953-PA 1..297 1..297 1521 100 Plus
CG7916-PA 287 CG7916-PA 19..278 36..296 434 36.3 Plus
CG8997-PB 260 CG8997-PB 36..260 63..296 356 34.5 Plus
CG8997-PA 260 CG8997-PA 36..260 63..296 356 34.5 Plus