Clone LP05734 Report

Search the DGRC for LP05734

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:57
Well:34
Vector:pOT2
Associated Gene/TranscriptHsp22-RA
Protein status:LP05734.pep: gold
Preliminary Size:944
Sequenced Size:973

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4460 2002-01-01 Sim4 clustering to Release 2
CG32041 2002-05-18 Blastp of sequenced clone
Hsp22 2008-04-29 Release 5.5 accounting
Hsp22 2008-08-15 Release 5.9 accounting
Hsp22 2008-12-18 5.12 accounting

Clone Sequence Records

LP05734.complete Sequence

973 bp (973 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119034

> LP05734.complete
ACCAACTGCTAACAACTCGAAGAAAGTCAACTAAATTAAAATTTCGCCAG
CTAAATAGAAATTTCATAGGATTGAAACTTCAGACAACAAGATTATCTTC
GAAACATAGAGGAAAAATTTAAAAAAAAGCCAAGAAGTATTTCAAAGACA
ACAATTGGACGGAATTTCATCAAATTATTCGAATTTGCATAAGAAGCTTT
TGTTGGAAAAACCAAGTTACCTTATTAACTACAATGCGTTCCTTACCGAT
GTTTTGGCGCATGGCCGAGGAGATGGCACGGATGCCACGCCTCTCCTCGC
CCTTTCACGCCTTCTTCCACGAGCCGCCCGTTTGGAGTGTGGCGCTACCG
AGGAACTGGCAGCAGATTGCCCGCTGGCAGGAGCAGGAGTTCGCTCCGCC
GGCCACCGTCAACAAGGATGGCTACAAACTCACCCTGGACGTCAAGGACT
ACAGCGAGCTAAAGGTCAAGGTGCTGGACGAGAGCGTTGTCCTGGTGGAG
GGAAAATCAGAGCAGCAGGAGGCCGAACAAGGTGGCTATAGCTCCAGGCA
CTTCCTCCGCCGCTTCGTCCTGCCGGAAGGATACGAGGCGGACAAGGTGA
CCTCAACGCTGAGCAGCGACGGCGTCCTGACCATCAGTGTGCCCAATCCT
CCAGGCGTGCAGGAGACACTCAAGGAGCGTGAGGTGACCATCGAGCAGAC
TGGCGAGCCGGCAAAGAAGTCCGCCGAGGAGCCAAATGACAAAGCCGCCA
GTCAGTAGAAATAAGTTAAGATTATACTAAAACCGATAAAATGCTAGTGA
ACTCCTATGTTTAGATATTCCAAAACCTATCAAATTTAAGTTCTTGTTAA
ATTAACAAGTTAATTTTAAAACAATTGTGATTCGGTAGCCCGCAAGCCCA
ATATTTTTATGTAGAAGAAAATAAATATTCGAAAAGACTATATGATCAAA
AAAAAAAAAAAAAAAAAAAAAAA

LP05734.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
Hsp22-RA 1906 Hsp22-RA 954..1904 1..951 4755 100 Plus
Hsp67Bb-RB 1906 Hsp67Bb-RB 954..1904 1..951 4755 100 Plus
Hsp22-RB 944 Hsp22-RB 1..944 1..944 4720 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9365915..9366856 1..941 4420 98.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:50:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9374018..9374968 1..951 4755 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:33:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9367118..9368068 1..951 4755 100 Plus
Blast to na_te.dros performed 2019-03-16 12:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmir\worf 4174 Dmir\worf WORF 4174bp Derived from AY144572. 4060..4163 942..834 109 60.9 Minus

LP05734.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:19:05 Download gff for LP05734.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9365915..9366860 1..947 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:36:52 Download gff for LP05734.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp22-RB 1..525 234..758 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:42:48 Download gff for LP05734.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp22-RB 1..525 234..758 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:11:35 Download gff for LP05734.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp22-RA 1..525 234..758 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:34:58 Download gff for LP05734.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp22-RB 1..525 234..758 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:42:28 Download gff for LP05734.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp22-RA 1..525 234..758 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:17:15 Download gff for LP05734.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp67Bb-RB 954..1900 1..947 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:42:48 Download gff for LP05734.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp67Bb-RB 954..1900 1..947 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:11:35 Download gff for LP05734.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp67Bb-RB 954..1900 1..947 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:34:58 Download gff for LP05734.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp67Bb-RB 954..1900 1..947 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:42:28 Download gff for LP05734.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp22-RA 954..1900 1..947 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:19:05 Download gff for LP05734.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9374018..9374964 1..947 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:19:05 Download gff for LP05734.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9374018..9374964 1..947 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:19:05 Download gff for LP05734.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9374018..9374964 1..947 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:11:35 Download gff for LP05734.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9367118..9368064 1..947 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:07:16 Download gff for LP05734.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9367118..9368064 1..947 100   Plus

LP05734.pep Sequence

Translation from 233 to 757

> LP05734.pep
MRSLPMFWRMAEEMARMPRLSSPFHAFFHEPPVWSVALPRNWQQIARWQE
QEFAPPATVNKDGYKLTLDVKDYSELKVKVLDESVVLVEGKSEQQEAEQG
GYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKERE
VTIEQTGEPAKKSAEEPNDKAASQ*

LP05734.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:54:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10689-PA 174 GF10689-PA 1..174 1..174 778 83.9 Plus
Dana\GF10691-PA 190 GF10691-PA 1..164 1..157 314 42.5 Plus
Dana\GF23739-PA 205 GF23739-PA 81..179 59..157 270 52.5 Plus
Dana\GF11829-PA 187 GF11829-PA 47..175 31..161 192 40.1 Plus
Dana\GF10692-PA 219 GF10692-PA 89..197 58..167 180 43.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:54:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15367-PA 173 GG15367-PA 1..172 1..172 871 95.9 Plus
Dere\GG15370-PA 187 GG15370-PA 1..181 1..174 291 39.6 Plus
Dere\GG14047-PA 208 GG14047-PA 82..182 57..157 255 48.5 Plus
Dere\GG14046-PA 445 GG14046-PA 119..232 57..167 208 39.7 Plus
Dere\GG14048-PA 199 GG14048-PA 73..173 57..157 196 45.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:54:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14586-PA 183 GH14586-PA 1..158 1..157 520 63.1 Plus
Dgri\GH14557-PA 171 GH14557-PA 1..142 17..157 437 60.4 Plus
Dgri\GH17008-PA 180 GH17008-PA 1..180 1..170 310 39.1 Plus
Dgri\GH23707-PA 185 GH23707-PA 1..185 1..170 298 38.3 Plus
Dgri\GH16863-PA 185 GH16863-PA 1..185 1..170 298 38.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:25
Subject Length Description Subject Range Query Range Score Percent Strand
Hsp22-PB 174 CG4460-PB 1..174 1..174 906 100 Plus
Hsp22-PA 174 CG4460-PA 1..174 1..174 906 100 Plus
Hsp23-PB 186 CG4463-PB 1..180 1..174 287 39.7 Plus
Hsp23-PA 186 CG4463-PA 1..180 1..174 287 39.7 Plus
Hsp26-PB 208 CG4183-PB 68..182 43..157 251 44.4 Plus
Hsp26-PA 208 CG4183-PA 68..182 43..157 251 44.4 Plus
Hsp27-PB 213 CG4466-PB 85..196 59..171 237 46.1 Plus
Hsp27-PA 213 CG4466-PA 85..196 59..171 237 46.1 Plus
Hsp67Ba-PA 445 CG4167-PA 120..241 57..174 211 40.3 Plus
CG4461-PA 200 CG4461-PA 73..196 39..160 198 34.4 Plus
l(2)efl-PC 187 CG4533-PC 64..176 49..162 187 42.2 Plus
l(2)efl-PA 187 CG4533-PA 64..176 49..162 187 42.2 Plus
Hsp67Bc-PA 199 CG4190-PA 76..173 60..157 184 46.5 Plus
CG13133-PA 217 CG13133-PA 79..198 56..174 179 36.9 Plus
CG7409-PA 154 CG7409-PA 53..146 59..157 146 38.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:54:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12244-PA 183 GI12244-PA 1..158 1..157 556 66.9 Plus
Dmoj\GI13085-PA 185 GI13085-PA 1..171 1..166 310 40.8 Plus
Dmoj\GI12247-PA 211 GI12247-PA 84..186 55..157 255 51.4 Plus
Dmoj\GI13087-PA 209 GI13087-PA 30..189 7..167 234 39.3 Plus
Dmoj\GI13088-PA 212 GI13088-PA 81..183 55..157 227 51.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22441-PA 177 GL22441-PA 1..164 1..164 736 84.8 Plus
Dper\GL22446-PA 184 GL22446-PA 1..164 1..157 297 42 Plus
Dper\GL22443-PA 184 GL22443-PA 1..164 1..157 297 42 Plus
Dper\GL22632-PA 204 GL22632-PA 76..178 55..157 242 45.7 Plus
Dper\GL22633-PA 196 GL22633-PA 55..173 42..157 203 41 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16631-PA 177 GA16631-PA 1..164 1..164 734 84.8 Plus
Dpse\GA18202-PA 184 GA18202-PA 1..164 1..157 295 41.4 Plus
Dpse\GA18011-PA 204 GA18011-PA 76..178 55..157 242 45.7 Plus
Dpse\GA24923-PA 196 GA24923-PA 55..173 42..157 198 40.2 Plus
Dpse\GA18238-PA 187 GA18238-PA 29..175 10..161 196 37.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:54:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25140-PA 173 GM25140-PA 1..172 1..172 899 98.3 Plus
Dsec\GM25142-PA 183 GM25142-PA 1..177 1..174 301 40.1 Plus
Dsec\GM24881-PA 211 GM24881-PA 79..182 56..157 257 50 Plus
Dsec\GM24880-PA 403 GM24880-PA 120..233 57..167 212 39.7 Plus
Dsec\GM24882-PA 199 GM24882-PA 76..173 60..157 194 46.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:54:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14174-PA 173 GD14174-PA 1..172 1..172 900 98.8 Plus
Dsim\GD14176-PA 177 GD14176-PA 1..171 1..174 258 34.6 Plus
Dsim\GD12933-PA 211 GD12933-PA 82..182 57..157 257 49.5 Plus
Dsim\GD12932-PA 391 GD12932-PA 66..179 57..167 210 39.7 Plus
Dsim\GD12934-PA 199 GD12934-PA 76..173 60..157 194 46.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11476-PA 131 GJ11476-PA 1..131 1..131 421 63.7 Plus
Dvir\GJ13834-PA 186 GJ13834-PA 1..172 1..166 312 40 Plus
Dvir\GJ11479-PA 216 GJ11479-PA 83..193 55..166 286 53.5 Plus
Dvir\GJ13836-PA 214 GJ13836-PA 82..192 55..166 280 52.6 Plus
Dvir\GJ13835-PA 211 GJ13835-PA 30..191 7..167 255 38.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17635-PA 177 GK17635-PA 1..165 1..166 670 73.5 Plus
Dwil\GK17636-PA 186 GK17636-PA 1..163 1..157 310 43.5 Plus
Dwil\GK16566-PA 216 GK16566-PA 88..187 59..157 264 48.5 Plus
Dwil\GK23172-PA 187 GK23172-PA 47..176 31..162 193 39.9 Plus
Dwil\GK19253-PA 192 GK19253-PA 76..172 60..157 189 43 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20830-PA 173 GE20830-PA 1..172 1..172 879 96.5 Plus
Dyak\GE20832-PA 186 GE20832-PA 1..180 1..174 297 39.1 Plus
Dyak\GE21250-PA 208 GE21250-PA 82..182 57..157 257 49.5 Plus
Dyak\Hsp67Bc-PA 199 GE21251-PA 76..173 60..157 191 45.5 Plus
Dyak\GE11545-PA 187 GE11545-PA 47..176 31..162 191 40.6 Plus

LP05734.hyp Sequence

Translation from 233 to 757

> LP05734.hyp
MRSLPMFWRMAEEMARMPRLSSPFHAFFHEPPVWSVALPRNWQQIARWQE
QEFAPPATVNKDGYKLTLDVKDYSELKVKVLDESVVLVEGKSEQQEAEQG
GYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKERE
VTIEQTGEPAKKSAEEPNDKAASQ*

LP05734.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:17
Subject Length Description Subject Range Query Range Score Percent Strand
Hsp22-PB 174 CG4460-PB 1..174 1..174 906 100 Plus
Hsp22-PA 174 CG4460-PA 1..174 1..174 906 100 Plus
Hsp23-PB 186 CG4463-PB 1..180 1..174 287 39.7 Plus
Hsp23-PA 186 CG4463-PA 1..180 1..174 287 39.7 Plus
Hsp26-PB 208 CG4183-PB 68..182 43..157 251 44.4 Plus