Clone LP05863 Report

Search the DGRC for LP05863

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:58
Well:63
Vector:pOT2
Associated Gene/TranscriptCG12057-RA
Protein status:LP05863.pep: gold
Preliminary Size:672
Sequenced Size:894

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12057 2002-01-01 Sim4 clustering to Release 2
CG12057 2002-05-18 Blastp of sequenced clone
CG12057 2003-01-01 Sim4 clustering to Release 3
CG12057 2008-04-29 Release 5.5 accounting
CG12057 2008-08-15 Release 5.9 accounting
CG12057 2008-12-18 5.12 accounting

Clone Sequence Records

LP05863.complete Sequence

894 bp (894 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119035

> LP05863.complete
AGTATCAAACATGAAGCAATACACCGTTGCCATTATCCTAACCCTTTTCG
TTGCCAGTGGATGGGCCCAACCGCTGGACATGCCCAGCCAGCTGGACGCC
CAGGTGCGCAGCGTGGTGGATGAGATGACCAGCATTGGCAAGGCGACCGG
CGAGGTACTGTTGAGTCAGTACGAAGAGATCGTCCTGGAGCCGCAAAACG
AATTGGAGGCAGCCGTCGAGCAGGTGGAGTCGCGTCGCGAGGAGAGTCCC
GAATGCGTGGCCGCCGAGGATGAGGAGATCACCCGCATCGTGAATGCCGC
CCATGAGGATCTGTACGCCTGCGGCGTTGTGGCCGCCCAGACATCCGCCG
AAATTGCCTCCGATGTGAGTGCCGCCACCCAGCAACTGGTCTACGGTGGC
TACAGCCTGGCCAGCACCTACAACAAATGCAACTCGTACAAGAACTCCGT
GCTGAAGCAGACCTGCTTGGCCAAGTTCTATGTCCAGGCCACCGTCTATT
TGGTCAGTGCGCGCTCCTCCATCAAGACCATCCGTCAGTCGACCAGCGAA
CGCATCCCGGACGTCTTCGCCGATGGCAATGTGTGCACCCACTCCGCATC
CTCGCAGGCGGTGCTCGGTCTCCAGGAGGTGAACAACAACATCGACGCCT
GCGTCTACCGTCGTCGCTAGGTGAACACAAACTTATTTACCTGGATTCTG
CAAATAAAAATTATGCATGTTCTATGCCAAATGTTATTTAGTTATTTTTT
TTTTTTTTGCAGTGTTGCTTGTTGCAGTGTGATTTGTGTGCTAACATTTT
AGAAAGAATTTATTTTAAAGTTCAATTTTTGTGTACGAAAGTATAAATAA
ATAACGGAGTTAATCGAAAAACTTAAAAAAAAAAAAAAAAAAAA

LP05863.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG12057-RA 877 CG12057-RA 3..877 1..875 4375 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 9083480..9084353 1..874 4310 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:50:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9191675..9192549 1..875 4375 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:33:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 9199773..9200647 1..875 4375 100 Plus
Blast to na_te.dros performed 2019-03-15 22:33:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_O 2986 Dbif\P-element_O P_O 2986bp Derived from X71634. 2672..2732 796..854 120 68.9 Plus

LP05863.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:33:58 Download gff for LP05863.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 9083480..9084353 1..874 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:37:02 Download gff for LP05863.complete
Subject Subject Range Query Range Percent Splice Strand
CG12057-RA 1..660 11..670 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:42:49 Download gff for LP05863.complete
Subject Subject Range Query Range Percent Splice Strand
CG12057-RA 1..660 11..670 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:24:55 Download gff for LP05863.complete
Subject Subject Range Query Range Percent Splice Strand
CG12057-RA 1..660 11..670 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:34:59 Download gff for LP05863.complete
Subject Subject Range Query Range Percent Splice Strand
CG12057-RA 1..660 11..670 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:27:58 Download gff for LP05863.complete
Subject Subject Range Query Range Percent Splice Strand
CG12057-RA 1..660 11..670 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:17:17 Download gff for LP05863.complete
Subject Subject Range Query Range Percent Splice Strand
CG12057-RA 3..876 1..874 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:42:49 Download gff for LP05863.complete
Subject Subject Range Query Range Percent Splice Strand
CG12057-RA 3..876 1..874 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:24:55 Download gff for LP05863.complete
Subject Subject Range Query Range Percent Splice Strand
CG12057-RA 19..892 1..874 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:34:59 Download gff for LP05863.complete
Subject Subject Range Query Range Percent Splice Strand
CG12057-RA 3..876 1..874 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:27:58 Download gff for LP05863.complete
Subject Subject Range Query Range Percent Splice Strand
CG12057-RA 19..892 1..874 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:58 Download gff for LP05863.complete
Subject Subject Range Query Range Percent Splice Strand
X 9191675..9192548 1..874 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:58 Download gff for LP05863.complete
Subject Subject Range Query Range Percent Splice Strand
X 9191675..9192548 1..874 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:58 Download gff for LP05863.complete
Subject Subject Range Query Range Percent Splice Strand
X 9191675..9192548 1..874 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:24:55 Download gff for LP05863.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9085708..9086581 1..874 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:07:18 Download gff for LP05863.complete
Subject Subject Range Query Range Percent Splice Strand
X 9199773..9200646 1..874 100   Plus

LP05863.hyp Sequence

Translation from 0 to 669

> LP05863.hyp
VSNMKQYTVAIILTLFVASGWAQPLDMPSQLDAQVRSVVDEMTSIGKATG
EVLLSQYEEIVLEPQNELEAAVEQVESRREESPECVAAEDEEITRIVNAA
HEDLYACGVVAAQTSAEIASDVSAATQQLVYGGYSLASTYNKCNSYKNSV
LKQTCLAKFYVQATVYLVSARSSIKTIRQSTSERIPDVFADGNVCTHSAS
SQAVLGLQEVNNNIDACVYRRR*

LP05863.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG12057-PB 219 CG12057-PB 1..219 4..222 1091 100 Plus
CG12057-PA 219 CG12057-PA 1..219 4..222 1091 100 Plus
CG12115-PA 263 CG12115-PA 72..258 31..217 230 30.9 Plus

LP05863.pep Sequence

Translation from 10 to 669

> LP05863.pep
MKQYTVAIILTLFVASGWAQPLDMPSQLDAQVRSVVDEMTSIGKATGEVL
LSQYEEIVLEPQNELEAAVEQVESRREESPECVAAEDEEITRIVNAAHED
LYACGVVAAQTSAEIASDVSAATQQLVYGGYSLASTYNKCNSYKNSVLKQ
TCLAKFYVQATVYLVSARSSIKTIRQSTSERIPDVFADGNVCTHSASSQA
VLGLQEVNNNIDACVYRRR*

LP05863.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22316-PA 210 GF22316-PA 2..210 3..219 850 72.8 Plus
Dana\GF22632-PA 256 GF22632-PA 47..251 10..215 262 32.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:51:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18295-PA 219 GG18295-PA 1..219 1..219 1014 87.2 Plus
Dere\GG18996-PA 261 GG18996-PA 71..257 28..214 192 28.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:51:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24734-PA 226 GH24734-PA 9..226 8..219 690 60.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG12057-PB 219 CG12057-PB 1..219 1..219 1091 100 Plus
CG12057-PA 219 CG12057-PA 1..219 1..219 1091 100 Plus
CG12115-PA 263 CG12115-PA 72..258 28..214 230 30.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15722-PA 223 GI15722-PA 9..219 8..217 686 61.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14650-PA 219 GL14650-PA 17..218 18..219 833 74.3 Plus
Dper\GL14677-PA 270 GL14677-PA 61..265 18..215 281 30.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11365-PA 219 GA11365-PA 17..218 18..219 837 74.3 Plus
Dpse\GA11409-PA 270 GA11409-PA 58..265 15..215 282 30.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13727-PA 219 GM13727-PA 1..219 1..219 1055 90.4 Plus
Dsec\GM13672-PA 253 GM13672-PA 35..248 2..214 209 30.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16935-PA 132 GD16935-PA 1..130 1..130 606 88.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15252-PA 225 GJ15252-PA 9..225 6..219 686 59 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25093-PA 217 GK25093-PA 1..216 1..217 726 59.2 Plus
Dwil\GK25844-PA 228 GK25844-PA 23..224 22..216 293 36.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15829-PA 219 GE15829-PA 1..219 1..219 1038 89 Plus
Dyak\GE17408-PA 261 GE17408-PA 66..257 23..214 197 29.9 Plus