Clone LP06027 Report

Search the DGRC for LP06027

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:60
Well:27
Vector:pOT2
Associated Gene/TranscriptCpr78E-RA
Protein status:LP06027.pep: gold
Preliminary Size:441
Sequenced Size:482

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7160 2002-01-01 Sim4 clustering to Release 2
CG7160 2002-05-18 Blastp of sequenced clone
CG7160 2003-01-01 Sim4 clustering to Release 3
Cpr78E 2008-04-29 Release 5.5 accounting
Cpr78E 2008-08-15 Release 5.9 accounting
Cpr78E 2008-12-18 5.12 accounting

Clone Sequence Records

LP06027.complete Sequence

482 bp (482 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119036

> LP06027.complete
CCAGCTTCCCCTCCAGACAGCAGCATGTTTAAGATTCTCATCGTCGCCCT
GTCCCTTTGCACGGCCGTCGTGCTGAGTGCTCCAGTGGACCACGTCACAT
CCACCACCCAGCCACCGGTGGCCATTCTCGAATCATCTCACGAAAAGCAC
GAGGATGGATCGTACAACTTCTCTTACCTCGGCGAGGACGGCACCCACAG
AAGGGAGGAGGCCGTGGTCAGAAACCAAGGCACCGAGAACGAGTACCTGG
AGATCAGCGGCTCCTACTCCTACTTCGATGCCAACGGACAGGAGGTGACC
GTCACCTACAAGGCCGATGACCACGGATTTGTACCAGAGGGCGGAGCAAT
CCTGCCCCAGATTTCGCTGGCCGCCAAGCAGGTCAGCGAGCAGGTGCCCC
AACCAGATCTTGACTATGCTAAGCCTCCTAAGGTCTAATAAACGAGGCAC
TGAAATGGAATCTAAAAAAAAAAAAAAAAAAA

LP06027.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr78E-RA 909 Cpr78E-RA 331..795 1..465 2325 100 Plus
Cpr78E.b 1078 Cpr78E.b 500..964 1..465 2325 100 Plus
Cpr78E.a 2365 Cpr78E.a 1787..2251 1..465 2325 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21655388..21655814 463..37 2135 100 Minus
chr3L 24539361 chr3L 21655881..21655916 36..1 180 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:50:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:50:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21666450..21666878 465..37 2145 100 Minus
3L 28110227 3L 21666945..21666980 36..1 180 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21659550..21659978 465..37 2145 100 Minus
3L 28103327 3L 21660045..21660080 36..1 180 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:50:28 has no hits.

LP06027.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:51:34 Download gff for LP06027.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21655388..21655814 37..463 100 <- Minus
chr3L 21655881..21655916 1..36 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:37:13 Download gff for LP06027.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78E-RA 1..414 25..438 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:42:34 Download gff for LP06027.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78E-RA 1..414 25..438 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:27:12 Download gff for LP06027.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78E-RA 1..414 25..438 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:34:45 Download gff for LP06027.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78E-RA 1..414 25..438 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:51:48 Download gff for LP06027.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78E-RA 1..414 25..438 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:16:57 Download gff for LP06027.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78E-RA 1..461 1..461 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:42:34 Download gff for LP06027.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78E-RA 1..461 1..461 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:27:12 Download gff for LP06027.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78E-RA 1..463 1..463 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:34:45 Download gff for LP06027.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78E-RA 1..461 1..461 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:51:48 Download gff for LP06027.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78E-RA 1..463 1..463 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:34 Download gff for LP06027.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21666452..21666878 37..463 100 <- Minus
3L 21666945..21666980 1..36 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:34 Download gff for LP06027.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21666452..21666878 37..463 100 <- Minus
3L 21666945..21666980 1..36 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:34 Download gff for LP06027.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21666452..21666878 37..463 100 <- Minus
3L 21666945..21666980 1..36 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:27:12 Download gff for LP06027.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21659552..21659978 37..463 100 <- Minus
arm_3L 21660045..21660080 1..36 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:07:02 Download gff for LP06027.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21659552..21659978 37..463 100 <- Minus
3L 21660045..21660080 1..36 100   Minus

LP06027.hyp Sequence

Translation from 0 to 437

> LP06027.hyp
PASPPDSSMFKILIVALSLCTAVVLSAPVDHVTSTTQPPVAILESSHEKH
EDGSYNFSYLGEDGTHRREEAVVRNQGTENEYLEISGSYSYFDANGQEVT
VTYKADDHGFVPEGGAILPQISLAAKQVSEQVPQPDLDYAKPPKV*

LP06027.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr78E-PA 137 CG7160-PA 1..137 9..145 708 100 Plus
Cpr47Eb-PA 214 CG13224-PA 1..136 9..141 227 42.3 Plus
Cpr47Ec-PA 131 CG9077-PA 1..118 9..130 210 42.3 Plus
Cpr47Ef-PD 601 CG13214-PD 121..231 27..129 199 39.6 Plus
Cpr47Ef-PC 612 CG13214-PC 121..231 27..129 199 39.6 Plus

LP06027.pep Sequence

Translation from 24 to 437

> LP06027.pep
MFKILIVALSLCTAVVLSAPVDHVTSTTQPPVAILESSHEKHEDGSYNFS
YLGEDGTHRREEAVVRNQGTENEYLEISGSYSYFDANGQEVTVTYKADDH
GFVPEGGAILPQISLAAKQVSEQVPQPDLDYAKPPKV*

LP06027.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24646-PA 137 GF24646-PA 1..137 1..137 659 88.3 Plus
Dana\GF12537-PA 207 GF12537-PA 1..123 1..122 210 42.7 Plus
Dana\GF12426-PA 130 GF12426-PA 1..122 1..126 178 35.4 Plus
Dana\GF12424-PA 613 GF12424-PA 118..195 32..109 176 43.6 Plus
Dana\GF10920-PA 111 GF10920-PA 6..105 6..106 164 37.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13213-PA 137 GG13213-PA 1..137 1..137 677 93.4 Plus
Dere\GG20182-PA 218 GG20182-PA 1..119 1..118 234 45.8 Plus
Dere\GG22685-PA 129 GG22685-PA 1..124 1..128 229 43.4 Plus
Dere\GG22683-PA 594 GG22683-PA 112..222 19..121 195 38.7 Plus
Dere\GG14078-PA 105 GG14078-PA 23..105 29..112 171 46.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15102-PA 131 GH15102-PA 1..131 1..130 429 64.1 Plus
Dgri\GH21942-PA 129 GH21942-PA 1..127 1..130 260 42.4 Plus
Dgri\GH19947-PA 265 GH19947-PA 1..122 1..121 234 43.1 Plus
Dgri\GH21941-PA 143 GH21941-PA 1..128 1..117 188 35.1 Plus
Dgri\GH15837-PA 104 GH15837-PA 6..101 5..109 187 40 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr78E-PA 137 CG7160-PA 1..137 1..137 708 100 Plus
Cpr47Eb-PA 214 CG13224-PA 1..136 1..133 227 42.3 Plus
Cpr47Ec-PA 131 CG9077-PA 1..118 1..122 210 42.3 Plus
Cpr47Ef-PD 601 CG13214-PD 121..231 19..121 199 39.6 Plus
Cpr47Ef-PC 612 CG13214-PC 121..231 19..121 199 39.6 Plus
Acp65Aa-PA 105 CG10297-PA 1..105 1..112 183 39.3 Plus
Cpr65Av-PA 111 CG32405-PA 6..105 6..106 161 37.1 Plus
Cpr47Ed-PA 127 CG9076-PA 1..101 1..104 161 40 Plus
Cpr65Ax2-PB 102 CG18777-PB 18..102 30..116 157 42.5 Plus
Cpr65Ax2-PA 102 CG18777-PA 18..102 30..116 157 42.5 Plus
Cpr65Ax1-PA 102 CG34270-PA 18..102 30..116 157 42.5 Plus
Lcp65Ac-PA 109 CG6956-PA 14..107 14..115 152 38.2 Plus
Cpr49Aa-PB 144 CG30045-PB 30..132 31..127 151 33 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13751-PA 145 GI13751-PA 28..143 25..136 353 62.4 Plus
Dmoj\GI19904-PA 384 GI19904-PA 1..125 1..118 202 39.2 Plus
Dmoj\GI19649-PA 184 GI19649-PA 54..163 9..118 189 43.6 Plus
Dmoj\GI12694-PA 101 GI12694-PA 19..101 29..112 173 47.6 Plus
Dmoj\GI12698-PA 111 GI12698-PA 1..105 1..106 165 37.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25283-PA 138 GL25283-PA 1..137 1..136 637 88.3 Plus
Dper\GL16751-PA 132 GL16751-PA 18..124 23..129 206 42.1 Plus
Dper\GL17720-PA 240 GL17720-PA 25..127 24..125 198 44.2 Plus
Dper\GL15560-PA 102 GL15560-PA 1..99 1..109 176 37.6 Plus
Dper\GL16750-PA 106 GL16750-PA 1..91 1..106 166 34.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20144-PA 138 GA20144-PA 1..137 1..136 637 88.3 Plus
Dpse\GA21523-PA 132 GA21523-PA 18..124 23..129 206 42.1 Plus
Dpse\GA12136-PA 240 GA12136-PA 25..127 24..125 198 44.2 Plus
Dpse\GA10226-PA 135 GA10226-PA 35..135 3..112 180 40 Plus
Dpse\GA21522-PA 106 GA21522-PA 1..91 1..106 174 37.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22121-PA 137 GM22121-PA 1..137 1..137 707 97.8 Plus
Dsec\GM21270-PA 214 GM21270-PA 1..119 1..118 235 45.8 Plus
Dsec\GM20463-PA 131 GM20463-PA 1..121 1..126 218 43.3 Plus
Dsec\GM20461-PA 598 GM20461-PA 126..236 19..121 195 38.7 Plus
Dsec\GM13861-PA 105 GM13861-PA 1..105 1..112 187 39.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12099-PA 137 GD12099-PA 1..137 1..137 701 97.8 Plus
Dsim\GD10782-PA 214 GD10782-PA 1..119 1..118 235 45.8 Plus
Dsim\GD25932-PA 131 GD25932-PA 9..121 4..126 215 43.9 Plus
Dsim\GD25930-PA 617 GD25930-PA 126..236 19..121 195 38.7 Plus
Dsim\GD13144-PA 105 GD13144-PA 1..105 1..112 187 39.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14096-PA 140 GJ14096-PA 1..138 1..136 442 64.7 Plus
Dvir\GJ15016-PA 129 GJ15016-PA 1..128 1..133 224 42.1 Plus
Dvir\GJ15073-PA 196 GJ15073-PA 1..126 1..126 220 40.9 Plus
Dvir\GJ15015-PA 145 GJ15015-PA 1..132 1..119 199 37.1 Plus
Dvir\GJ12742-PA 102 GJ12742-PA 1..99 2..109 175 37 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17131-PA 137 GK17131-PA 1..137 1..137 550 74.5 Plus
Dwil\GK20647-PA 131 GK20647-PA 1..126 1..125 235 44.2 Plus
Dwil\GK20958-PA 197 GK20958-PA 5..130 4..123 224 40.5 Plus
Dwil\GK16917-PA 107 GK16917-PA 1..107 1..112 184 40.2 Plus
Dwil\GK16920-PA 111 GK16920-PA 1..105 1..106 165 37.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:49:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22707-PA 137 GE22707-PA 1..137 1..137 663 92 Plus
Dyak\GE22306-PA 137 GE22306-PA 1..137 1..137 660 91.2 Plus
Dyak\GE13040-PA 129 GE13040-PA 1..124 1..124 245 46.1 Plus
Dyak\GE12869-PA 216 GE12869-PA 1..136 1..133 239 42.3 Plus
Dyak\GE20502-PA 195 GE20502-PA 1..105 1..112 186 39.3 Plus