Clone LP06209 Report

Search the DGRC for LP06209

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:62
Well:9
Vector:pOT2
Associated Gene/Transcriptcer-RA
Protein status:LP06209.pep: gold
Preliminary Size:488
Sequenced Size:503

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10460 2002-01-01 Sim4 clustering to Release 2
cer 2008-04-29 Stopped prior to 5.5
cer 2008-12-18 5.12 accounting

Clone Sequence Records

LP06209.complete Sequence

503 bp assembled on 2008-10-21

GenBank Submission: BT050545.1

> LP06209.complete
CTTTGTTGTGTTTATATGTTGTGACTCAGTGCGAAACCGTGATAAAACCT
GAGAATTGAAACGAAATTTAGTCGGTCACCAAAATTACAAGTGTCAAGAT
GTCCCTGGTTTCAGATGAGGAGTGGGTGGAGTACAAGTCCAAGTTCGACA
AGAACTACGAGGCAGAGGAGGATCTGATGCGTCGTAGAATCTACGCCGAG
TCCAAAGCCCGGATTGAGGAACACAATCGGAAGTTCGAGAAGGGCGAAGT
GACTTGGAAAATGGGAATTAATCATTTGGCTGATCTCACGCCTGAGGAAT
TTGCCCAGCGTTGTGGCAAAAAGGTGCCGCCAAATTAACAGAATCTCAAG
TGAATCTCATTTTAAATAGACATTTTGTAAAGACACTAATCTCTCTGTAA
TTCTATAAATATGCATTTGAATTTTTAAATCTTTATCGTTCAACCACCCC
CAAATAAACAATAAATCAGCTGTTTTGTACATTTTAAAAAAAAAAAAAAA
AAA

LP06209.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
cer-RA 682 cer-RA 170..657 1..488 2440 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15283380..15283729 485..136 1660 98.3 Minus
chr2R 21145070 chr2R 15283789..15283925 137..1 685 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:50:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19396212..19396564 488..136 1765 100 Minus
2R 25286936 2R 19396624..19396760 137..1 685 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:28:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19397411..19397763 488..136 1765 100 Minus
2R 25260384 2R 19397823..19397959 137..1 685 100 Minus
Blast to na_te.dros performed on 2019-03-16 01:35:59 has no hits.

LP06209.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:36:48 Download gff for LP06209.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15283380..15283727 138..485 98 <- Minus
chr2R 15283789..15283925 1..137 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:37:18 Download gff for LP06209.complete
Subject Subject Range Query Range Percent Splice Strand
cer-RA 1..240 99..338 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:15:28 Download gff for LP06209.complete
Subject Subject Range Query Range Percent Splice Strand
cer-RA 1..240 99..338 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:41:14 Download gff for LP06209.complete
Subject Subject Range Query Range Percent Splice Strand
cer-RA 1..240 99..338 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:37:25 Download gff for LP06209.complete
Subject Subject Range Query Range Percent Splice Strand
cer-RA 1..240 99..338 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:55:03 Download gff for LP06209.complete
Subject Subject Range Query Range Percent Splice Strand
cer-RA 1..485 1..485 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:15:28 Download gff for LP06209.complete
Subject Subject Range Query Range Percent Splice Strand
cer-RA 15..499 1..485 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:41:14 Download gff for LP06209.complete
Subject Subject Range Query Range Percent Splice Strand
cer-RA 13..497 1..485 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-21 18:38:50 Download gff for LP06209.complete
Subject Subject Range Query Range Percent Splice Strand
cer-RA 1..485 1..485 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:37:25 Download gff for LP06209.complete
Subject Subject Range Query Range Percent Splice Strand
cer-RA 13..497 1..485 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:36:48 Download gff for LP06209.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19396215..19396562 138..485 100 <- Minus
2R 19396624..19396760 1..137 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:36:48 Download gff for LP06209.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19396215..19396562 138..485 100 <- Minus
2R 19396624..19396760 1..137 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:36:48 Download gff for LP06209.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19396215..19396562 138..485 100 <- Minus
2R 19396624..19396760 1..137 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:41:14 Download gff for LP06209.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15283720..15284067 138..485 100 <- Minus
arm_2R 15284129..15284265 1..137 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:46:20 Download gff for LP06209.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19397414..19397761 138..485 100 <- Minus
2R 19397823..19397959 1..137 100   Minus

LP06209.hyp Sequence

Translation from 98 to 337

> LP06209.hyp
MSLVSDEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGE
VTWKMGINHLADLTPEEFAQRCGKKVPPN*

LP06209.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:13:03
Subject Length Description Subject Range Query Range Score Percent Strand
cer-PA 79 CG10460-PA 1..79 1..79 423 100 Plus
Cp1-PA 341 CG6692-PA 27..91 7..70 138 41.5 Plus
Cp1-PC 371 CG6692-PC 57..121 7..70 138 41.5 Plus

LP06209.pep Sequence

Translation from 98 to 337

> LP06209.pep
MSLVSDEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGE
VTWKMGINHLADLTPEEFAQRCGKKVPPN*

LP06209.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12610-PA 74 GF12610-PA 1..74 1..74 316 77 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20910-PA 79 GG20910-PA 1..78 1..78 409 98.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22972-PA 77 GH22972-PA 1..75 1..75 251 54.7 Plus
Dgri\GH17548-PA 77 GH17548-PA 1..75 1..75 245 53.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
cer-PA 79 CG10460-PA 1..79 1..79 423 100 Plus
Cp1-PA 341 CG6692-PA 27..91 7..70 138 41.5 Plus
Cp1-PC 371 CG6692-PC 57..121 7..70 138 41.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18458-PA 78 GI18458-PA 1..77 1..77 272 58.4 Plus
Dmoj\GI20850-PA 329 GI20850-PA 22..87 4..68 135 36.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11253-PA 79 GL11253-PA 1..78 1..78 307 69.2 Plus
Dper\GL15686-PA 323 GL15686-PA 24..88 8..71 139 38.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:11:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10327-PA 79 GA10327-PA 1..78 1..78 307 69.2 Plus
Dpse\GA23505-PA 323 GA23505-PA 24..88 8..71 138 38.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:11:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19834-PA 79 GM19834-PA 1..79 1..79 418 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:11:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25324-PA 79 GD25324-PA 1..79 1..79 418 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:11:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21545-PA 78 GJ21545-PA 1..75 1..75 267 58.7 Plus
Dvir\GJ11310-PA 328 GJ11310-PA 22..90 4..71 155 40.6 Plus
Dvir\GJ11311-PA 311 GJ11311-PA 22..90 4..71 153 40.6 Plus
Dvir\GJ20585-PA 333 GJ20585-PA 22..88 4..69 141 35.8 Plus
Dvir\GJ21741-PA 328 GJ21741-PA 23..91 1..68 137 40.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:12:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22212-PA 80 GK22212-PA 1..79 1..78 293 68.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:12:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13849-PA 79 GE13849-PA 1..79 1..79 407 96.2 Plus