Clone LP06338 Report

Search the DGRC for LP06338

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:63
Well:38
Vector:pOT2
Associated Gene/TranscriptAg5r-RA
Protein status:LP06338.pep: gold
Preliminary Size:1175
Sequenced Size:1038

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9538 2001-01-01 Release 2 assignment
CG9538 2001-11-09 Blastp of sequenced clone
CG9538 2003-01-01 Sim4 clustering to Release 3
Ag5r 2008-04-29 Release 5.5 accounting
Ag5r 2008-08-15 Release 5.9 accounting
Ag5r 2008-12-18 5.12 accounting

Clone Sequence Records

LP06338.complete Sequence

1038 bp (1038 high quality bases) assembled on 2001-11-09

GenBank Submission: AY069740

> LP06338.complete
ATAGAAATGCGCAACTTCGTGATCATATTTAGCCTATCTCTGGCATTTGG
CATCGCCTCCGCCACCGATTATTGCAAAAAGAGCTGCGGAAGCACCAAGA
ATCTGGGATGCGACAATAATGGAGCCTGGGCCTCAAGCTGTCCCAGTGAC
GCCACCCTGTTGACCCTCTCCAGCGCTGAGAAGGATGCACTGGTGGCCAG
GACGAACGAGTATCGCAACCACATCGCCGGCGGACTGAATGCCAATCTGA
GTGCCGCCTGTCGAATGGCCACGATCAAGTGGAACGATGAACTGGCTTAC
TTGGCCAGTTTGAACGTGAAAAGTTGTCAAATGAAACACGACGGCTGCCA
CAATACGGATGCTTTCGACTGGTCTGGCCAGAATCTGGCCTGGATGGGCT
ACTACAATCCGCTAAATGTTACACACTATCTAGAATGGGGCGTCGATATG
TGGTACGATGAGGCGGTGTACACCAAACAGGCCTACATCGATGCCTATCC
GTCGAACTACAATGGTCCGGCCATTGGACATTTCACGGTGCTCGTTGCCG
ATCGGAATACGGAAGTGGGTTGTGCCGCGGCCACGTACTCCGTGTCCGGC
CAATCGTACAAGGCCTTCCTGCTGGCCTGTAACTATGCGGCCACCAATGT
TCTGGGCATCAAGATGTACAGTTCCTGCTCCAAGGCGGCCAGCAAGTGTA
CCACCGGTACCAATCCCAAGTACAAGTATCTGTGCAGCGCCAAGGAGGAG
TACAACGTAAACAACCTCTTCTATTGAGGCAATAAATAGATGCTACGATC
GGTTCAATTATTTAAATATATGTATATATAATCAAATCAATAGAAGGGTA
GGGTGGACCTTATTATCAAAGATTAACTAAAGCACTGAGATAATAGGAGA
ATCGTATGTGATTCGAAACTGTTTATAAAGTTATGCAGCATATCTGTAAC
ATTCCTATTAGTTTTAAAATACAAATACGGGATAAATTCTAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LP06338.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
Ag5r-RA 1260 Ag5r-RA 172..1166 1..995 4975 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:35:26
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 14675395..14676261 990..124 4320 99.9 Minus
chrX 22417052 chrX 14676390..14676513 124..1 605 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:50:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:35:24
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 14785094..14785965 995..124 4360 100 Minus
X 23542271 X 14786093..14786216 124..1 620 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:25:24
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 14793192..14794063 995..124 4360 100 Minus
X 23527363 X 14794191..14794314 124..1 620 100 Minus
Blast to na_te.dros performed on 2019-03-16 04:35:24 has no hits.

LP06338.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:36:04 Download gff for LP06338.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 14675395..14676261 124..990 99 <- Minus
chrX 14676391..14676513 1..123 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:37:21 Download gff for LP06338.complete
Subject Subject Range Query Range Percent Splice Strand
Ag5r-RA 1..771 7..777 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:33:47 Download gff for LP06338.complete
Subject Subject Range Query Range Percent Splice Strand
Ag5r-RA 1..771 7..777 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:35:35 Download gff for LP06338.complete
Subject Subject Range Query Range Percent Splice Strand
Ag5r-RA 1..771 7..777 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:01:22 Download gff for LP06338.complete
Subject Subject Range Query Range Percent Splice Strand
Ag5r-RA 1..771 7..777 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:45:12 Download gff for LP06338.complete
Subject Subject Range Query Range Percent Splice Strand
Ag5r-RA 1..771 7..777 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:13:00 Download gff for LP06338.complete
Subject Subject Range Query Range Percent Splice Strand
Ag5r-RA 18..1007 1..990 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:33:46 Download gff for LP06338.complete
Subject Subject Range Query Range Percent Splice Strand
Ag5r-RA 18..1007 1..990 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:35:35 Download gff for LP06338.complete
Subject Subject Range Query Range Percent Splice Strand
Ag5r-RA 22..1011 1..990 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:01:22 Download gff for LP06338.complete
Subject Subject Range Query Range Percent Splice Strand
Ag5r-RA 18..1007 1..990 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:45:12 Download gff for LP06338.complete
Subject Subject Range Query Range Percent Splice Strand
Ag5r-RA 22..1011 1..990 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:36:04 Download gff for LP06338.complete
Subject Subject Range Query Range Percent Splice Strand
X 14786094..14786216 1..123 100   Minus
X 14785099..14785965 124..990 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:36:04 Download gff for LP06338.complete
Subject Subject Range Query Range Percent Splice Strand
X 14786094..14786216 1..123 100   Minus
X 14785099..14785965 124..990 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:36:04 Download gff for LP06338.complete
Subject Subject Range Query Range Percent Splice Strand
X 14786094..14786216 1..123 100   Minus
X 14785099..14785965 124..990 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:35:35 Download gff for LP06338.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14679132..14679998 124..990 100 <- Minus
arm_X 14680127..14680249 1..123 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:38:14 Download gff for LP06338.complete
Subject Subject Range Query Range Percent Splice Strand
X 14793197..14794063 124..990 100 <- Minus
X 14794192..14794314 1..123 100   Minus

LP06338.hyp Sequence

Translation from 0 to 776

> LP06338.hyp
IEMRNFVIIFSLSLAFGIASATDYCKKSCGSTKNLGCDNNGAWASSCPSD
ATLLTLSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAY
LASLNVKSCQMKHDGCHNTDAFDWSGQNLAWMGYYNPLNVTHYLEWGVDM
WYDEAVYTKQAYIDAYPSNYNGPAIGHFTVLVADRNTEVGCAAATYSVSG
QSYKAFLLACNYAATNVLGIKMYSSCSKAASKCTTGTNPKYKYLCSAKEE
YNVNNLFY*

LP06338.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
Ag5r-PC 256 CG9538-PC 1..256 3..258 1388 100 Plus
Ag5r-PB 256 CG9538-PB 1..256 3..258 1388 100 Plus
Ag5r-PA 256 CG9538-PA 1..256 3..258 1388 100 Plus
Ag5r2-PA 254 CG9540-PA 9..253 12..255 637 50.4 Plus
CG9822-PA 263 CG9822-PA 1..263 1..258 422 36.6 Plus

LP06338.pep Sequence

Translation from 6 to 776

> LP06338.pep
MRNFVIIFSLSLAFGIASATDYCKKSCGSTKNLGCDNNGAWASSCPSDAT
LLTLSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAYLA
SLNVKSCQMKHDGCHNTDAFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWY
DEAVYTKQAYIDAYPSNYNGPAIGHFTVLVADRNTEVGCAAATYSVSGQS
YKAFLLACNYAATNVLGIKMYSSCSKAASKCTTGTNPKYKYLCSAKEEYN
VNNLFY*

LP06338.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:26:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19647-PA 218 GF19647-PA 1..218 40..256 1029 88.5 Plus
Dana\GF21598-PA 255 GF21598-PA 1..253 1..252 588 45.5 Plus
Dana\GF21595-PA 256 GF21595-PA 5..256 1..251 499 43.4 Plus
Dana\GF21134-PA 248 GF21134-PA 18..247 17..243 492 41.8 Plus
Dana\GF12100-PA 263 GF12100-PA 6..263 4..255 393 36.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:26:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19449-PA 256 GG19449-PA 1..256 1..256 1290 94.5 Plus
Dere\GG19450-PA 288 GG19450-PA 37..286 4..252 622 50 Plus
Dere\GG18928-PA 253 GG18928-PA 7..249 4..252 424 38.4 Plus
Dere\GG17625-PA 248 GG17625-PA 8..248 5..244 422 37.6 Plus
Dere\GG20782-PA 263 GG20782-PA 30..263 21..256 396 37.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:26:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12214-PA 256 GH12214-PA 1..256 1..256 959 67.2 Plus
Dgri\GH24697-PA 274 GH24697-PA 24..270 7..252 468 38.4 Plus
Dgri\GH12213-PA 256 GH12213-PA 2..256 1..251 466 39.5 Plus
Dgri\GH12878-PA 260 GH12878-PA 27..257 19..253 421 39.1 Plus
Dgri\GH17451-PA 253 GH17451-PA 5..253 4..251 407 37.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:03
Subject Length Description Subject Range Query Range Score Percent Strand
Ag5r-PC 256 CG9538-PC 1..256 1..256 1388 100 Plus
Ag5r-PB 256 CG9538-PB 1..256 1..256 1388 100 Plus
Ag5r-PA 256 CG9538-PA 1..256 1..256 1388 100 Plus
Ag5r2-PA 254 CG9540-PA 9..253 10..253 637 50.4 Plus
CG9822-PA 263 CG9822-PA 6..263 4..256 419 36.9 Plus
CG32679-PA 254 CG32679-PA 10..250 6..252 405 36.7 Plus
CG42780-PA 253 CG42780-PA 8..251 7..244 390 36.8 Plus
CG42780-PB 254 CG42780-PB 8..252 7..244 386 37.1 Plus
scpr-C-PB 262 CG5106-PB 3..251 1..250 369 32.5 Plus
scpr-C-PA 262 CG5106-PA 3..251 1..250 369 32.5 Plus
scpr-B-PA 262 CG17210-PA 9..251 10..250 368 33.3 Plus
CG6628-PA 277 CG6628-PA 26..260 17..249 367 37.1 Plus
scpr-A-PA 264 CG5207-PA 6..253 5..250 366 33.1 Plus
CG17974-PA 259 CG17974-PA 10..258 7..252 344 34.3 Plus
CG42564-PA 500 CG10284-PA 54..283 21..249 324 34.9 Plus
CG17575-PA 291 CG17575-PA 22..287 19..254 316 31.6 Plus
CG9400-PA 308 CG9400-PA 72..288 35..250 311 32.9 Plus
CG17575-PB 298 CG17575-PB 22..294 19..254 299 30.8 Plus
CG3640-PA 296 CG3640-PA 8..253 4..252 296 30.6 Plus
CG30486-PA 263 CG30486-PA 17..257 17..254 292 29.9 Plus
CG34002-PB 350 CG34002-PB 12..255 5..247 285 28.9 Plus
CG31296-PB 280 CG31296-PB 3..254 1..252 247 29.2 Plus
CG31296-PA 280 CG31296-PA 3..254 1..252 247 29.2 Plus
CG10651-PB 316 CG10651-PB 7..251 6..247 228 28.9 Plus
CG10651-PA 316 CG10651-PA 7..251 6..247 228 28.9 Plus
CG8072-PA 247 CG8072-PA 21..240 19..243 189 28.5 Plus
CG8483-PA 392 CG8483-PA 20..226 42..256 164 27.2 Plus
CG43776-PA 270 CG43776-PA 72..265 67..254 152 28.4 Plus
CG43776-PB 270 CG43776-PB 72..265 67..254 152 28.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:26:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15747-PA 256 GI15747-PA 1..256 1..256 880 64.5 Plus
Dmoj\GI15745-PA 257 GI15745-PA 1..256 1..256 789 56.2 Plus
Dmoj\GI15744-PA 256 GI15744-PA 1..256 1..251 512 44.8 Plus
Dmoj\Tes104-PA 260 GI22692-PA 1..249 1..250 414 36.1 Plus
Dmoj\GI20472-PA 267 GI20472-PA 40..263 30..252 387 37.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:26:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20409-PA 257 GL20409-PA 1..257 1..256 1125 81.3 Plus
Dper\GL20410-PA 254 GL20410-PA 17..252 18..252 591 48.7 Plus
Dper\GL11847-PA 263 GL11847-PA 6..257 4..252 396 34.6 Plus
Dper\GL20408-PA 162 GL20408-PA 1..162 90..251 370 47.9 Plus
Dper\GL14627-PA 248 GL14627-PA 6..233 5..231 366 37.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:26:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21864-PA 257 GA21864-PA 1..257 1..256 1116 80.5 Plus
Dpse\GA21866-PA 254 GA21866-PA 17..252 18..252 591 48.7 Plus
Dpse\GA29233-PA 258 GA29233-PA 2..258 1..251 511 42.3 Plus
Dpse\GA23354-PA 263 GA23354-PA 19..259 6..252 413 36.7 Plus
Dpse\GA28431-PA 253 GA28431-PA 11..250 10..248 404 38.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:26:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12039-PA 256 GM12039-PA 1..256 1..256 1310 96.5 Plus
Dsec\GM12040-PA 254 GM12040-PA 3..252 4..252 607 48.8 Plus
Dsec\GM15726-PA 263 GM15726-PA 6..263 4..256 402 36.1 Plus
Dsec\GM11319-PA 237 GM11319-PA 8..233 21..252 378 37.8 Plus
Dsec\GM24819-PA 277 GM24819-PA 9..261 5..250 365 35.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23705-PA 168 GD23705-PA 1..166 87..252 437 51.2 Plus
Dsim\GD25203-PA 263 GD25203-PA 6..263 4..256 403 36.1 Plus
Dsim\GD16039-PA 254 GD16039-PA 8..250 4..252 398 36.4 Plus
Dsim\GD18744-PA 277 GD18744-PA 6..258 5..255 370 32.8 Plus
Dsim\GD25202-PA 258 GD25202-PA 1..257 1..252 354 34.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18606-PA 256 GJ18606-PA 1..256 1..256 984 69.1 Plus
Dvir\GJ14736-PA 270 GJ14736-PA 18..264 7..252 527 45 Plus
Dvir\GJ10116-PA 253 GJ10116-PA 2..253 1..251 451 38.8 Plus
Dvir\GJ18605-PA 253 GJ18605-PA 2..253 1..251 450 43.4 Plus
Dvir\GJ22322-PA 262 GJ22322-PA 13..258 10..252 413 37.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18446-PA 263 GK18446-PA 11..263 5..256 1076 76.7 Plus
Dwil\GK14719-PA 256 GK14719-PA 19..254 18..252 583 48.7 Plus
Dwil\GK14741-PA 240 GK14741-PA 1..240 16..251 545 46.5 Plus
Dwil\GK18435-PA 257 GK18435-PA 23..257 19..251 513 46 Plus
Dwil\GK14730-PA 256 GK14730-PA 22..256 21..251 462 40.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Ag5r-PA 256 GE16102-PA 1..256 1..256 1261 91.4 Plus
Dyak\GE16103-PA 283 GE16103-PA 32..281 4..252 609 48.8 Plus
Dyak\GE13719-PA 263 GE13719-PA 6..263 4..255 416 38.4 Plus
Dyak\GE15398-PA 253 GE15398-PA 13..249 10..252 401 38.1 Plus
Dyak\GE17527-PA 247 GE17527-PA 33..247 30..244 373 39.4 Plus