Clone LP06572 Report

Search the DGRC for LP06572

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:65
Well:72
Vector:pOT2
Associated Gene/TranscriptObp99b-RA
Protein status:LP06572.pep: gold
Preliminary Size:450
Sequenced Size:568

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7592 2002-01-01 Sim4 clustering to Release 2
CG7592 2002-05-18 Blastp of sequenced clone
Obp99b 2008-04-29 Release 5.5 accounting
Obp99b 2008-08-15 Release 5.9 accounting
Obp99b 2008-12-18 5.12 accounting

Clone Sequence Records

LP06572.complete Sequence

568 bp (568 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119044

> LP06572.complete
GTAAACATACATCAGCATGAAGGTTCTCATCGTTCTCCTATTGGGTCTGG
CCTTTGTCCTGGCCGATCACCATCACCATCACCACGACTATGTGGTGAAG
ACGCACGAGGATCTGACCAACTATCGCACGCAGTGCGTGGAGAAGGTTCA
CGCCAGCGAGGAGCTCGTGGAGAAGTACAAGAAGTGGCAGTACCCCGATG
ACGCGGTGACCCACTGCTACCTGGAGTGCATCTTCCAGAAGTTCGGCTTC
TACGACACCGAGCACGGATTCGATGTCCACAAGATCCACATCCAGCTGGC
CGGCCCTGGAGTTGAGGTGCACGAATCGGACGAGGTGCACCAGAAGATCG
CCCACTGCGCCGAGACCCACTCCAAGGAGGGCGACTCCTGCTCGAAGGCC
TACCACGCCGGCATGTGCTTCATGAACTCCAACCTGCAGCTGGTGCAGCA
CAGCGTCAAGGTCTAAAGGGAGCATGGATCCAGCCATCCAGAACCATCTG
ATCGCTTGTCTAAAGTTCAAGTCGTAAATAAAGTATTTGTTTAACGGCCC
AAAAAAAAAAAAAAAAAA

LP06572.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:54:53
Subject Length Description Subject Range Query Range Score Percent Strand
Obp99b-RA 560 Obp99b-RA 8..560 1..553 2765 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:33:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25538851..25539400 550..1 2690 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:51:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29716251..29716803 553..1 2765 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29457082..29457634 553..1 2765 100 Minus
Blast to na_te.dros performed 2019-03-15 22:33:20
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 7609..7647 360..322 105 74.4 Minus

LP06572.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:34:00 Download gff for LP06572.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25538851..25539400 1..550 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:37:30 Download gff for LP06572.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99b-RA 1..450 17..466 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:20 Download gff for LP06572.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99b-RA 1..450 17..466 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:24:58 Download gff for LP06572.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99b-RA 1..450 17..466 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:34:42 Download gff for LP06572.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99b-RA 1..450 17..466 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:28:03 Download gff for LP06572.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99b-RA 1..450 17..466 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:04:06 Download gff for LP06572.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99b-RA 8..557 1..550 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:20 Download gff for LP06572.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99b-RA 8..557 1..550 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:24:58 Download gff for LP06572.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99b-RA 25..574 1..550 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:34:42 Download gff for LP06572.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99b-RA 8..557 1..550 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:28:03 Download gff for LP06572.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99b-RA 25..574 1..550 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:34:00 Download gff for LP06572.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29716254..29716803 1..550 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:34:00 Download gff for LP06572.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29716254..29716803 1..550 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:34:00 Download gff for LP06572.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29716254..29716803 1..550 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:24:58 Download gff for LP06572.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25541976..25542525 1..550 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:16:38 Download gff for LP06572.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29457085..29457634 1..550 100   Minus

LP06572.pep Sequence

Translation from 16 to 465

> LP06572.pep
MKVLIVLLLGLAFVLADHHHHHHDYVVKTHEDLTNYRTQCVEKVHASEEL
VEKYKKWQYPDDAVTHCYLECIFQKFGFYDTEHGFDVHKIHIQLAGPGVE
VHESDEVHQKIAHCAETHSKEGDSCSKAYHAGMCFMNSNLQLVQHSVKV*

LP06572.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:27:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22870-PA 151 GF22870-PA 1..151 1..149 571 71.7 Plus
Dana\GF22872-PA 164 GF22872-PA 1..145 1..146 419 57 Plus
Dana\GF22871-PA 142 GF22871-PA 1..142 1..144 399 54.8 Plus
Dana\GF23357-PA 142 GF23357-PA 1..138 1..147 295 36.7 Plus
Dana\GF11209-PA 144 GF11209-PA 7..141 3..148 217 30.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:27:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11676-PA 144 GG11676-PA 5..140 3..147 266 35.2 Plus
Dere\GG10672-PA 143 GG10672-PA 7..141 3..148 237 34.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:27:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13991-PA 157 GH13991-PA 33..157 24..149 397 58.7 Plus
Dgri\GH18907-PA 149 GH18907-PA 5..138 3..147 304 40 Plus
Dgri\GH19983-PA 144 GH19983-PA 7..140 3..147 226 32.4 Plus
Dgri\GH14285-PA 149 GH14285-PA 1..142 1..144 137 22.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:33
Subject Length Description Subject Range Query Range Score Percent Strand
Obp99b-PB 149 CG7592-PB 1..149 1..149 823 100 Plus
Obp99b-PA 149 CG7592-PA 1..149 1..149 823 100 Plus
Obp99a-PB 142 CG18111-PB 5..138 3..147 290 37.9 Plus
Obp99a-PA 142 CG18111-PA 5..138 3..147 290 37.9 Plus
Obp44a-PB 143 CG2297-PB 7..141 3..148 216 34.9 Plus
Obp44a-PA 143 CG2297-PA 7..141 3..148 216 34.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:27:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22335-PA 154 GI22335-PA 13..154 14..149 402 58 Plus
Dmoj\GI23406-PA 142 GI23406-PA 5..138 3..147 281 37.2 Plus
Dmoj\GI20270-PA 144 GI20270-PA 7..141 3..148 232 32.9 Plus
Dmoj\GI23179-PA 147 GI23179-PA 6..143 7..144 160 27.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:27:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13580-PA 156 GL13580-PA 32..156 25..149 527 74.4 Plus
Dper\GL13898-PA 142 GL13898-PA 1..138 1..147 270 34.7 Plus
Dper\GL17379-PA 144 GL17379-PA 7..142 3..148 230 33.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:27:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp99b-PA 156 GA20463-PA 32..156 25..149 527 74.4 Plus
Dpse\Obp99a-PA 142 GA14801-PA 1..138 1..147 270 34.7 Plus
Dpse\Obp44a-PA 144 GA15343-PA 7..142 3..148 230 33.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:27:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12228-PA 149 GM12228-PA 1..149 1..149 781 100 Plus
Dsec\GM12800-PA 142 GM12800-PA 5..138 3..147 283 37.9 Plus
Dsec\GM20719-PA 143 GM20719-PA 7..141 3..148 236 34.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:27:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp99b-PA 149 GD17685-PA 1..149 1..149 781 100 Plus
Dsim\Obp99a-PA 142 GD21447-PA 5..138 3..147 283 37.2 Plus
Dsim\Obp44a-PA 143 GD10185-PA 7..141 3..148 236 34.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:27:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp99b-PA 162 GJ10523-PA 34..162 20..149 395 57.7 Plus
Dvir\Obp99a-PA 142 GJ10612-PA 1..138 1..147 302 38.1 Plus
Dvir\Obp44a-PA 144 GJ20223-PA 7..141 3..148 235 34.9 Plus
Dvir\Obp83g-PA 148 GJ14492-PA 3..142 4..144 148 24.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:27:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11170-PA 158 GK11170-PA 1..158 1..149 408 51.3 Plus
Dwil\GK11908-PA 142 GK11908-PA 5..138 3..147 289 37.9 Plus
Dwil\GK23043-PA 144 GK23043-PA 7..141 3..148 224 34.9 Plus
Dwil\GK14209-PA 144 GK14209-PA 1..142 1..146 138 24 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:27:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10437-PA 149 GE10437-PA 1..149 1..149 725 96 Plus
Dyak\Obp99a-PA 144 GE23865-PA 1..140 1..147 279 36.1 Plus
Dyak\GE23275-PA 143 GE23275-PA 7..141 3..148 245 36.3 Plus

LP06572.hyp Sequence

Translation from 16 to 465

> LP06572.hyp
MKVLIVLLLGLAFVLADHHHHHHDYVVKTHEDLTNYRTQCVEKVHASEEL
VEKYKKWQYPDDAVTHCYLECIFQKFGFYDTEHGFDVHKIHIQLAGPGVE
VHESDEVHQKIAHCAETHSKEGDSCSKAYHAGMCFMNSNLQLVQHSVKV*

LP06572.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
Obp99b-PB 149 CG7592-PB 1..149 1..149 823 100 Plus
Obp99b-PA 149 CG7592-PA 1..149 1..149 823 100 Plus
Obp99a-PB 142 CG18111-PB 5..138 3..147 290 37.9 Plus
Obp99a-PA 142 CG18111-PA 5..138 3..147 290 37.9 Plus
Obp44a-PB 143 CG2297-PB 7..141 3..148 216 34.9 Plus