Clone LP06586 Report

Search the DGRC for LP06586

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:65
Well:86
Vector:pOT2
Associated Gene/TranscriptCG34282-RA
Protein status:LP06586.pep: Chosen to match blastx hit
Preliminary Size:460
Sequenced Size:445

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7710 2002-01-01 Sim4 clustering to Release 2
CG7710 2002-05-18 Blastp of sequenced clone
CG7710 2003-01-01 Sim4 clustering to Release 3
CG34282 2008-04-29 Release 5.5 accounting

Clone Sequence Records

LP06586.complete Sequence

445 bp (445 high quality bases) assembled on 2009-02-20

GenBank Submission: AY119045.1

> LP06586.complete
ATCATCTGCTGCCTGCTGTTGGGCCTGTTCCTGGCCCTCAGCTCCGCCTA
CAATGGCCAAGACATCTATGCCGAGCCCAATTGCGCCATTGTCGAGGATC
ACGCTCGCAAGTTCCGCGACATCTCGGACCCCACCCACTACTGGGTGTGC
CCCGAGGGTCAGGAGAAGGCTGACTACATCCAGTGCCCGGACAACTACGC
CTTCATGGAGCAGCAGCAGAACTGCGTCGTCTGGGAGGAGTGGAAGTGGG
TCGAGCCCTACACCAAATAAACAGCCAACTTTCGCACTCTTGCTGAACGT
CTAAGCCGTTTATGTTTCCTTTCTGCCGCCAAGTTTTGATTGGATTCGAT
TGGATTTACGGCTCAGTGGTGGTTGGATCAGTGGTGGTGCAAATAAATTA
ATTATGTGTCCTGGCACACAGTCAAACAAAAAAAAAAAAAAAAAA

LP06586.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:24:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG34282-RA 735 CG34282-RA 150..578 1..429 2145 100 Plus
CG34282.a 735 CG34282.a 150..578 1..429 2145 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:44:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14519471..14519897 1..427 2135 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:51:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:44:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18695350..18695778 1..429 2145 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18436181..18436609 1..429 2145 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:44:23 has no hits.

LP06586.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:45:15 Download gff for LP06586.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14519471..14519897 1..427 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:37:32 Download gff for LP06586.complete
Subject Subject Range Query Range Percent Splice Strand
CG34282-RA 16..285 1..270 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:36:30 Download gff for LP06586.complete
Subject Subject Range Query Range Percent Splice Strand
CG34282-RA 16..285 1..270 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:18:06 Download gff for LP06586.complete
Subject Subject Range Query Range Percent Splice Strand
CG34282-RA 16..285 1..270 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:34:37 Download gff for LP06586.complete
Subject Subject Range Query Range Percent Splice Strand
CG34282-RA 16..285 1..270 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:47:56 Download gff for LP06586.complete
Subject Subject Range Query Range Percent Splice Strand
CG34282-RA 16..285 1..270 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-20 11:33:27 Download gff for LP06586.complete
Subject Subject Range Query Range Percent Splice Strand
CG34282-RA 16..442 1..427 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:36:30 Download gff for LP06586.complete
Subject Subject Range Query Range Percent Splice Strand
CG34282-RA 16..442 1..427 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:18:06 Download gff for LP06586.complete
Subject Subject Range Query Range Percent Splice Strand
CG34282-RA 30..456 1..427 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:34:37 Download gff for LP06586.complete
Subject Subject Range Query Range Percent Splice Strand
CG34282-RA 16..442 1..427 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:47:56 Download gff for LP06586.complete
Subject Subject Range Query Range Percent Splice Strand
CG34282-RA 30..456 1..427 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:45:15 Download gff for LP06586.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18695350..18695776 1..427 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:45:15 Download gff for LP06586.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18695350..18695776 1..427 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:45:15 Download gff for LP06586.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18695350..18695776 1..427 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:18:06 Download gff for LP06586.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14521072..14521498 1..427 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:10:07 Download gff for LP06586.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18436181..18436607 1..427 100   Plus

LP06586.pep Sequence

Translation from 0 to 269

> LP06586.pep
IICCLLLGLFLALSSAYNGQDIYAEPNCAIVEDHARKFRDISDPTHYWVC
PEGQEKADYIQCPDNYAFMEQQQNCVVWEEWKWVEPYTK*

LP06586.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:08:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17122-PA 94 GF17122-PA 6..94 1..89 449 91 Plus
Dana\GF16454-PA 79 GF16454-PA 2..70 18..86 153 40.6 Plus
Dana\GF18205-PA 97 GF18205-PA 5..88 1..86 137 35.6 Plus
Dana\GF14680-PA 91 GF14680-PA 8..87 5..86 136 35.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:08:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23053-PA 94 GG23053-PA 6..94 1..89 405 94.4 Plus
Dere\GG12307-PA 99 GG12307-PA 10..94 6..89 135 37.5 Plus
Dere\GG11500-PA 86 GG11500-PA 2..77 18..86 132 34.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:08:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18629-PA 94 GH18629-PA 6..94 1..89 425 86.5 Plus
Dgri\GH18866-PA 98 GH18866-PA 5..88 1..86 138 34.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG34282-PB 94 CG34282-PB 6..94 1..89 510 100 Plus
CG34282-PA 94 CG34282-PA 6..94 1..89 510 100 Plus
CG14246-PC 93 CG14246-PC 2..84 18..86 143 31.3 Plus
CG14246-PB 93 CG14246-PB 2..84 18..86 143 31.3 Plus
CG14246-PA 93 CG14246-PA 2..84 18..86 143 31.3 Plus
CG14645-PA 97 CG14645-PA 10..88 6..86 138 36.6 Plus
CG3348-PB 98 CG3348-PB 21..82 25..86 135 35.5 Plus
CG3348-PA 98 CG3348-PA 21..82 25..86 135 35.5 Plus
Peritrophin-15a-PA 92 CG17814-PA 8..88 5..83 131 32.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:08:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10808-PA 131 GI10808-PA 43..131 1..89 426 84.3 Plus
Dmoj\GI24723-PA 97 GI24723-PA 5..88 1..86 150 35.6 Plus
Dmoj\GI24570-PA 89 GI24570-PA 18..80 24..86 134 34.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24428-PA 94 GL24428-PA 19..94 14..89 384 90.8 Plus
Dper\GL12319-PA 97 GL12319-PA 5..88 1..86 141 35.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13143-PA 97 GA13143-PA 5..88 1..86 141 35.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17886-PA 94 GM17886-PA 6..94 1..89 480 100 Plus
Dsec\GM10746-PA 97 GM10746-PA 10..88 6..86 131 37.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19245-PA 94 GD19245-PA 6..94 1..89 480 100 Plus
Dsim\GD22405-PA 92 GD22405-PA 8..91 5..87 139 34.1 Plus
Dsim\GD19718-PA 97 GD19718-PA 10..88 6..86 132 37.8 Plus
Dsim\GD21302-PA 91 GD21302-PA 2..82 18..86 131 34.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14406-PA 94 GJ14406-PA 6..94 1..89 423 85.4 Plus
Dvir\GJ14550-PA 97 GJ14550-PA 5..88 1..86 140 34.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13738-PA 94 GK13738-PA 17..94 12..89 376 85.9 Plus
Dwil\GK11657-PA 99 GK11657-PA 3..89 5..86 130 39.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25556-PA 94 GE25556-PA 6..94 1..89 473 97.8 Plus
Dyak\GE23690-PA 89 GE23690-PA 2..80 18..86 131 34.2 Plus
Dyak\GE25408-PA 97 GE25408-PA 10..88 6..86 128 36.6 Plus

LP06586.hyp Sequence

Translation from 0 to 303

> LP06586.hyp
SSAACCWACSWPSAPPTMAKTSMPSPIAPLSRITLASSATSRTPPTTGCA
PRVRRRLTTSSARTTTPSWSSSRTASSGRSGSGSSPTPNKQPTFALLLNV
*
Sequence LP06586.hyp has no blast hits.