Clone LP06614 Report

Search the DGRC for LP06614

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:66
Well:14
Vector:pOT2
Associated Gene/TranscriptRpLP2-RA
Protein status:LP06614.pep: gold
Sequenced Size:582

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
RpLP2 2008-12-18 5.12 accounting

Clone Sequence Records

LP06614.complete Sequence

582 bp assembled on 2008-12-08

GenBank Submission: BT053726.1

> LP06614.complete
TTTTTCGTACATTTTGCCAATTCACGTTTCGTGTCAAGAACCCAAGACTT
AAACATGCGTTACGTGGCTGCTTACCTTCTGGCCGTCCTCGGTGGCAAGG
ACTCGCCCGCCAACAGCGATCTGGAGAAGATCCTCAGCTCTGTGGGCGTT
GAGGTCGACGCCGAGCGTCTGACCAAGGTCATCAAGGAGCTGGCTGGCAA
GAGCATCGACGACCTGATCAAGGAGGGTCGCGAGAAGCTCTCCTCGATGC
CGGTGGGCGGCGGTGGTGCCGTCGCAGCCGCTGATGCCGCACCCGCTGCC
GCCGCCGGTGGCGACAAGAAGGAGGCCAAGAAGGAGGAGAAGAAGGAGGA
GTCCGAGTCCGAGGATGACGACATGGGCTTCGCTCTCTTCGAATAAGCGG
TTGAATGTGGCGAATATACTGTGCAACACACTTGCGAGGCGAGAAAGCAG
CGTTCTGGAGCAGCCATTCATACATGGCCGGCCAGTCTACACACTTGTGT
AGCACCCATCCGTTCACCATTTCTACGTAATAAAAATCAGCAGTGTTTGC
ACTTTATATAAACCAAAAAAAAAAAAAAAAAA

LP06614.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
RpLP2-RA 599 RpLP2-RA 36..599 1..564 2820 100 Plus
RpLP2-RB 639 RpLP2-RB 76..639 1..564 2820 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12473409..12473957 1..564 2530 97 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:51:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16586169..16586734 1..566 2830 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16587368..16587933 1..566 2830 100 Plus
Blast to na_te.dros performed on 2019-03-15 17:02:10 has no hits.

LP06614.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:02:58 Download gff for LP06614.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12473409..12473887 1..479 99 == Plus
chr2R 12473888..12473957 495..564 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:00:57 Download gff for LP06614.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP2-RB 1..342 55..396 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:21:22 Download gff for LP06614.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP2-RB 1..342 55..396 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:25:52 Download gff for LP06614.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP2-RA 1..342 55..396 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:23:43 Download gff for LP06614.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP2-RA 1..342 55..396 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-08 17:10:43 Download gff for LP06614.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP2-RB 76..639 1..564 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:21:22 Download gff for LP06614.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP2-RB 76..639 1..564 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:25:52 Download gff for LP06614.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP2-RA 41..604 1..564 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:23:43 Download gff for LP06614.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP2-RA 41..604 1..564 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:02:58 Download gff for LP06614.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16586169..16586732 1..564 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:02:58 Download gff for LP06614.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16586169..16586732 1..564 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:02:58 Download gff for LP06614.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16586169..16586732 1..564 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:25:52 Download gff for LP06614.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12473674..12474237 1..564 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:52:59 Download gff for LP06614.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16587368..16587931 1..564 100   Plus

LP06614.pep Sequence

Translation from 0 to 395

> LP06614.pep
FFVHFANSRFVSRTQDLNMRYVAAYLLAVLGGKDSPANSDLEKILSSVGV
EVDAERLTKVIKELAGKSIDDLIKEGREKLSSMPVGGGGAVAAADAAPAA
AAGGDKKEAKKEEKKEESESEDDDMGFALFE*

LP06614.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:29:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20176-PA 113 GF20176-PA 1..113 19..131 337 79.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:29:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20616-PA 113 GG20616-PA 1..113 19..131 305 95.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:29:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24075-PA 114 GH24075-PA 1..67 19..85 307 89.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:27
Subject Length Description Subject Range Query Range Score Percent Strand
RpLP2-PA 113 CG4918-PA 1..113 19..131 551 100 Plus
RpLP1-PB 112 CG4087-PB 28..112 41..131 146 43.6 Plus
RpLP1-PA 112 CG4087-PA 28..112 41..131 146 43.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:29:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14471-PA 197 GI14471-PA 91..153 23..88 256 77.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:29:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20703-PA 114 GL20703-PA 1..114 19..131 404 79.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:29:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27615-PA 114 GA27615-PA 1..114 19..131 455 82.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21711-PA 113 GM21711-PA 1..113 19..131 542 99.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11208-PA 113 GD11208-PA 1..113 19..131 539 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18810-PA 115 GJ18810-PA 1..67 19..85 302 88.1 Plus
Dvir\GJ11145-PA 77 GJ11145-PA 1..63 19..85 232 71.6 Plus
Dvir\GJ11144-PA 77 GJ11144-PA 1..63 19..85 232 71.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:29:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25676-PA 116 GK25676-PA 1..67 19..85 311 91 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:29:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpLP2-PA 113 GE11806-PA 1..113 19..131 300 94.7 Plus

LP06614.hyp Sequence

Translation from 0 to 395

> LP06614.hyp
FFVHFANSRFVSRTQDLNMRYVAAYLLAVLGGKDSPANSDLEKILSSVGV
EVDAERLTKVIKELAGKSIDDLIKEGREKLSSMPVGGGGAVAAADAAPAA
AAGGDKKEAKKEEKKEESESEDDDMGFALFE*

LP06614.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:34:39
Subject Length Description Subject Range Query Range Score Percent Strand
RpLP2-PA 113 CG4918-PA 1..113 19..131 551 100 Plus
RpLP1-PB 112 CG4087-PB 28..112 41..131 146 43.6 Plus
RpLP1-PA 112 CG4087-PA 28..112 41..131 146 43.6 Plus