BDGP Sequence Production Resources |
Search the DGRC for LP06614
Library: | LP |
Tissue Source: | Drosophila melanogaster larval-early pupal |
Created by: | Ling Hong |
Date Registered: | 1998-06-11 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 66 |
Well: | 14 |
Vector: | pOT2 |
Associated Gene/Transcript | RpLP2-RA |
Protein status: | LP06614.pep: gold |
Sequenced Size: | 582 |
Gene | Date | Evidence |
---|---|---|
RpLP2 | 2008-12-18 | 5.12 accounting |
582 bp assembled on 2008-12-08
GenBank Submission: BT053726.1
> LP06614.complete TTTTTCGTACATTTTGCCAATTCACGTTTCGTGTCAAGAACCCAAGACTT AAACATGCGTTACGTGGCTGCTTACCTTCTGGCCGTCCTCGGTGGCAAGG ACTCGCCCGCCAACAGCGATCTGGAGAAGATCCTCAGCTCTGTGGGCGTT GAGGTCGACGCCGAGCGTCTGACCAAGGTCATCAAGGAGCTGGCTGGCAA GAGCATCGACGACCTGATCAAGGAGGGTCGCGAGAAGCTCTCCTCGATGC CGGTGGGCGGCGGTGGTGCCGTCGCAGCCGCTGATGCCGCACCCGCTGCC GCCGCCGGTGGCGACAAGAAGGAGGCCAAGAAGGAGGAGAAGAAGGAGGA GTCCGAGTCCGAGGATGACGACATGGGCTTCGCTCTCTTCGAATAAGCGG TTGAATGTGGCGAATATACTGTGCAACACACTTGCGAGGCGAGAAAGCAG CGTTCTGGAGCAGCCATTCATACATGGCCGGCCAGTCTACACACTTGTGT AGCACCCATCCGTTCACCATTTCTACGTAATAAAAATCAGCAGTGTTTGC ACTTTATATAAACCAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 12473409..12473957 | 1..564 | 2530 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 16586169..16586734 | 1..566 | 2830 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 16587368..16587933 | 1..566 | 2830 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 12473409..12473887 | 1..479 | 99 | == | Plus |
chr2R | 12473888..12473957 | 495..564 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpLP2-RB | 1..342 | 55..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpLP2-RB | 1..342 | 55..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpLP2-RA | 1..342 | 55..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpLP2-RA | 1..342 | 55..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpLP2-RB | 76..639 | 1..564 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpLP2-RB | 76..639 | 1..564 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpLP2-RA | 41..604 | 1..564 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpLP2-RA | 41..604 | 1..564 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16586169..16586732 | 1..564 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16586169..16586732 | 1..564 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16586169..16586732 | 1..564 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 12473674..12474237 | 1..564 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16587368..16587931 | 1..564 | 100 | Plus |
Translation from 0 to 395
> LP06614.pep FFVHFANSRFVSRTQDLNMRYVAAYLLAVLGGKDSPANSDLEKILSSVGV EVDAERLTKVIKELAGKSIDDLIKEGREKLSSMPVGGGGAVAAADAAPAA AAGGDKKEAKKEEKKEESESEDDDMGFALFE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20176-PA | 113 | GF20176-PA | 1..113 | 19..131 | 337 | 79.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20616-PA | 113 | GG20616-PA | 1..113 | 19..131 | 305 | 95.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24075-PA | 114 | GH24075-PA | 1..67 | 19..85 | 307 | 89.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpLP2-PA | 113 | CG4918-PA | 1..113 | 19..131 | 551 | 100 | Plus |
RpLP1-PB | 112 | CG4087-PB | 28..112 | 41..131 | 146 | 43.6 | Plus |
RpLP1-PA | 112 | CG4087-PA | 28..112 | 41..131 | 146 | 43.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI14471-PA | 197 | GI14471-PA | 91..153 | 23..88 | 256 | 77.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL20703-PA | 114 | GL20703-PA | 1..114 | 19..131 | 404 | 79.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA27615-PA | 114 | GA27615-PA | 1..114 | 19..131 | 455 | 82.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21711-PA | 113 | GM21711-PA | 1..113 | 19..131 | 542 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11208-PA | 113 | GD11208-PA | 1..113 | 19..131 | 539 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18810-PA | 115 | GJ18810-PA | 1..67 | 19..85 | 302 | 88.1 | Plus |
Dvir\GJ11145-PA | 77 | GJ11145-PA | 1..63 | 19..85 | 232 | 71.6 | Plus |
Dvir\GJ11144-PA | 77 | GJ11144-PA | 1..63 | 19..85 | 232 | 71.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25676-PA | 116 | GK25676-PA | 1..67 | 19..85 | 311 | 91 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\RpLP2-PA | 113 | GE11806-PA | 1..113 | 19..131 | 300 | 94.7 | Plus |
Translation from 0 to 395
> LP06614.hyp FFVHFANSRFVSRTQDLNMRYVAAYLLAVLGGKDSPANSDLEKILSSVGV EVDAERLTKVIKELAGKSIDDLIKEGREKLSSMPVGGGGAVAAADAAPAA AAGGDKKEAKKEEKKEESESEDDDMGFALFE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpLP2-PA | 113 | CG4918-PA | 1..113 | 19..131 | 551 | 100 | Plus |
RpLP1-PB | 112 | CG4087-PB | 28..112 | 41..131 | 146 | 43.6 | Plus |
RpLP1-PA | 112 | CG4087-PA | 28..112 | 41..131 | 146 | 43.6 | Plus |