Clone LP06769 Report

Search the DGRC for LP06769

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:67
Well:69
Vector:pOT2
Associated Gene/TranscriptTotB-RA
Protein status:LP06769.pep: gold
Preliminary Size:522
Sequenced Size:536

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5609 2002-01-01 Sim4 clustering to Release 2
CG5609 2002-05-18 Blastp of sequenced clone
CG5609 2003-01-01 Sim4 clustering to Release 3
TotB 2008-04-29 Release 5.5 accounting
TotB 2008-08-15 Release 5.9 accounting
TotB 2008-12-18 5.12 accounting

Clone Sequence Records

LP06769.complete Sequence

536 bp (536 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119051

> LP06769.complete
CACTTGCATTCCATTAAGTCCTTACAAAATGAATTTTAAAACGTCTTTGA
TCTGTTTCGCACTGCTACTGATTGGAACTCTATGCTCGGCCTATTCCAAT
CAAGAACGTCAACGTGACAGTCGTAGGGTTGCTGAAATTATGCGAACCTC
CTGGGACGACAATACCAAAATCAAAAGAATCCAGGAACTACTTACCATAT
ACAATCGCATGGCTCCTAGCTTAAGACCAGATGAAAGGGCGAGAATGGAC
AGATTCATAAGTGGATATACGGGAGAAATCATGGTCGATGGAGTACCCAG
TCAAGGTGGTGCTAGAAGGATCTTTAAGAAGATTCTGTCTCCGGCGGCAA
AGAGCGTGGCAACTGGATTCTTTACCGAACTCGGTGCAAGTCTTGCAAGC
ATATTAACTAGCTGGTTTCCAGCTAACACAGAACGAAACCATTGAAATCG
TAGACATCTTTTTTGTAATAAAATCAATTCCCCACTGAAAGTGAAAGTGA
AAGCATTGAAAGAGAAAAAAAAAAAAAAAAAAAAAA

LP06769.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
TotB-RA 674 TotB-RA 80..594 1..515 2575 100 Plus
TotB.a 2684 TotB.a 232..746 1..515 2575 100 Plus
TotB.b 3547 TotB.b 80..594 1..515 2575 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16697939..16698401 52..514 2315 100 Plus
chr3R 27901430 chr3R 16697829..16697879 1..51 255 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:51:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20874060..20874523 52..515 2320 100 Plus
3R 32079331 3R 20873950..20874000 1..51 255 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20614891..20615354 52..515 2320 100 Plus
3R 31820162 3R 20614781..20614831 1..51 255 100 Plus
Blast to na_te.dros performed 2019-03-16 02:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 5117..5186 137..206 143 67.1 Plus

LP06769.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:54:37 Download gff for LP06769.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16697829..16697879 1..51 100 -> Plus
chr3R 16697939..16698401 52..514 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:37:42 Download gff for LP06769.complete
Subject Subject Range Query Range Percent Splice Strand
TotB-RA 1..417 29..445 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:42:33 Download gff for LP06769.complete
Subject Subject Range Query Range Percent Splice Strand
TotB-RA 1..417 29..445 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:40:34 Download gff for LP06769.complete
Subject Subject Range Query Range Percent Splice Strand
TotB-RA 1..417 29..445 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:34:43 Download gff for LP06769.complete
Subject Subject Range Query Range Percent Splice Strand
TotB-RA 1..417 29..445 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:24:14 Download gff for LP06769.complete
Subject Subject Range Query Range Percent Splice Strand
TotB-RA 1..417 29..445 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:16:55 Download gff for LP06769.complete
Subject Subject Range Query Range Percent Splice Strand
TotB-RA 1..514 1..514 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:42:33 Download gff for LP06769.complete
Subject Subject Range Query Range Percent Splice Strand
TotB-RA 1..514 1..514 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:40:34 Download gff for LP06769.complete
Subject Subject Range Query Range Percent Splice Strand
TotB-RA 13..526 1..514 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:34:43 Download gff for LP06769.complete
Subject Subject Range Query Range Percent Splice Strand
TotB-RA 1..514 1..514 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:24:14 Download gff for LP06769.complete
Subject Subject Range Query Range Percent Splice Strand
TotB-RA 13..526 1..514 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:54:37 Download gff for LP06769.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20873950..20874000 1..51 100 -> Plus
3R 20874060..20874522 52..514 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:54:37 Download gff for LP06769.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20873950..20874000 1..51 100 -> Plus
3R 20874060..20874522 52..514 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:54:37 Download gff for LP06769.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20873950..20874000 1..51 100 -> Plus
3R 20874060..20874522 52..514 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:40:34 Download gff for LP06769.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16699672..16699722 1..51 100 -> Plus
arm_3R 16699782..16700244 52..514 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:07:00 Download gff for LP06769.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20614891..20615353 52..514 100   Plus
3R 20614781..20614831 1..51 100 -> Plus

LP06769.hyp Sequence

Translation from 0 to 444

> LP06769.hyp
TCIPLSPYKMNFKTSLICFALLLIGTLCSAYSNQERQRDSRRVAEIMRTS
WDDNTKIKRIQELLTIYNRMAPSLRPDERARMDRFISGYTGEIMVDGVPS
QGGARRIFKKILSPAAKSVATGFFTELGASLASILTSWFPANTERNH*

LP06769.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:11:09
Subject Length Description Subject Range Query Range Score Percent Strand
TotB-PA 138 CG5609-PA 1..138 10..147 704 100 Plus
TotA-PA 129 CG31509-PA 1..128 10..136 348 52.3 Plus
TotC-PA 129 CG31508-PA 1..128 10..136 336 53.1 Plus

LP06769.pep Sequence

Translation from 28 to 444

> LP06769.pep
MNFKTSLICFALLLIGTLCSAYSNQERQRDSRRVAEIMRTSWDDNTKIKR
IQELLTIYNRMAPSLRPDERARMDRFISGYTGEIMVDGVPSQGGARRIFK
KILSPAAKSVATGFFTELGASLASILTSWFPANTERNH*

LP06769.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:49:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24210-PA 129 GG24210-PA 1..128 1..127 401 59.4 Plus
Dere\GG24221-PA 129 GG24221-PA 1..128 1..127 398 59.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:46
Subject Length Description Subject Range Query Range Score Percent Strand
TotB-PA 138 CG5609-PA 1..138 1..138 704 100 Plus
TotA-PA 129 CG31509-PA 1..128 1..127 348 52.3 Plus
TotC-PA 129 CG31508-PA 1..128 1..127 336 53.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16288-PB 154 GA16288-PB 34..143 20..122 215 40.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23145-PA 139 GM23145-PA 1..139 1..138 642 88.5 Plus
Dsec\GM23144-PA 129 GM23144-PA 1..128 1..127 377 56.2 Plus
Dsec\GM23143-PA 129 GM23143-PA 1..128 1..127 359 50.8 Plus
Dsec\GM23142-PA 129 GM23142-PA 1..128 1..127 359 50.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19384-PA 139 GD19384-PA 1..139 1..138 652 89.9 Plus
Dsim\GD19383-PA 129 GD19383-PA 1..128 1..127 377 56.2 Plus
Dsim\GD19381-PA 129 GD19381-PA 1..128 1..127 364 52.3 Plus
Dsim\GD19382-PA 129 GD19382-PA 1..128 1..127 359 50.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:49:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25695-PA 139 GE25695-PA 1..139 1..138 542 72.7 Plus
Dyak\GE18068-PA 140 GE18068-PA 1..109 1..108 428 73.4 Plus
Dyak\GE25694-PA 129 GE25694-PA 1..128 1..127 347 50.8 Plus