LP06769.complete Sequence
536 bp (536 high quality bases) assembled on 2002-05-18
GenBank Submission: AY119051
> LP06769.complete
CACTTGCATTCCATTAAGTCCTTACAAAATGAATTTTAAAACGTCTTTGA
TCTGTTTCGCACTGCTACTGATTGGAACTCTATGCTCGGCCTATTCCAAT
CAAGAACGTCAACGTGACAGTCGTAGGGTTGCTGAAATTATGCGAACCTC
CTGGGACGACAATACCAAAATCAAAAGAATCCAGGAACTACTTACCATAT
ACAATCGCATGGCTCCTAGCTTAAGACCAGATGAAAGGGCGAGAATGGAC
AGATTCATAAGTGGATATACGGGAGAAATCATGGTCGATGGAGTACCCAG
TCAAGGTGGTGCTAGAAGGATCTTTAAGAAGATTCTGTCTCCGGCGGCAA
AGAGCGTGGCAACTGGATTCTTTACCGAACTCGGTGCAAGTCTTGCAAGC
ATATTAACTAGCTGGTTTCCAGCTAACACAGAACGAAACCATTGAAATCG
TAGACATCTTTTTTGTAATAAAATCAATTCCCCACTGAAAGTGAAAGTGA
AAGCATTGAAAGAGAAAAAAAAAAAAAAAAAAAAAA
LP06769.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:01:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TotB-RA | 674 | TotB-RA | 80..594 | 1..515 | 2575 | 100 | Plus |
TotB.a | 2684 | TotB.a | 232..746 | 1..515 | 2575 | 100 | Plus |
TotB.b | 3547 | TotB.b | 80..594 | 1..515 | 2575 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:53:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 16697939..16698401 | 52..514 | 2315 | 100 | Plus |
chr3R | 27901430 | chr3R | 16697829..16697879 | 1..51 | 255 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:51:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:53:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 20874060..20874523 | 52..515 | 2320 | 100 | Plus |
3R | 32079331 | 3R | 20873950..20874000 | 1..51 | 255 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:33:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 20614891..20615354 | 52..515 | 2320 | 100 | Plus |
3R | 31820162 | 3R | 20614781..20614831 | 1..51 | 255 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 02:53:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
17.6 | 7439 | 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). | 5117..5186 | 137..206 | 143 | 67.1 | Plus |
LP06769.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:54:37 Download gff for
LP06769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 16697829..16697879 | 1..51 | 100 | -> | Plus |
chr3R | 16697939..16698401 | 52..514 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:37:42 Download gff for
LP06769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotB-RA | 1..417 | 29..445 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:42:33 Download gff for
LP06769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotB-RA | 1..417 | 29..445 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:40:34 Download gff for
LP06769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotB-RA | 1..417 | 29..445 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:34:43 Download gff for
LP06769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotB-RA | 1..417 | 29..445 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:24:14 Download gff for
LP06769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotB-RA | 1..417 | 29..445 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:16:55 Download gff for
LP06769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotB-RA | 1..514 | 1..514 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:42:33 Download gff for
LP06769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotB-RA | 1..514 | 1..514 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:40:34 Download gff for
LP06769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotB-RA | 13..526 | 1..514 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:34:43 Download gff for
LP06769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotB-RA | 1..514 | 1..514 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:24:14 Download gff for
LP06769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotB-RA | 13..526 | 1..514 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:54:37 Download gff for
LP06769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 20873950..20874000 | 1..51 | 100 | -> | Plus |
3R | 20874060..20874522 | 52..514 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:54:37 Download gff for
LP06769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 20873950..20874000 | 1..51 | 100 | -> | Plus |
3R | 20874060..20874522 | 52..514 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:54:37 Download gff for
LP06769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 20873950..20874000 | 1..51 | 100 | -> | Plus |
3R | 20874060..20874522 | 52..514 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:40:34 Download gff for
LP06769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 16699672..16699722 | 1..51 | 100 | -> | Plus |
arm_3R | 16699782..16700244 | 52..514 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:07:00 Download gff for
LP06769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 20614891..20615353 | 52..514 | 100 | | Plus |
3R | 20614781..20614831 | 1..51 | 100 | -> | Plus |
LP06769.hyp Sequence
Translation from 0 to 444
> LP06769.hyp
TCIPLSPYKMNFKTSLICFALLLIGTLCSAYSNQERQRDSRRVAEIMRTS
WDDNTKIKRIQELLTIYNRMAPSLRPDERARMDRFISGYTGEIMVDGVPS
QGGARRIFKKILSPAAKSVATGFFTELGASLASILTSWFPANTERNH*
LP06769.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:11:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TotB-PA | 138 | CG5609-PA | 1..138 | 10..147 | 704 | 100 | Plus |
TotA-PA | 129 | CG31509-PA | 1..128 | 10..136 | 348 | 52.3 | Plus |
TotC-PA | 129 | CG31508-PA | 1..128 | 10..136 | 336 | 53.1 | Plus |
LP06769.pep Sequence
Translation from 28 to 444
> LP06769.pep
MNFKTSLICFALLLIGTLCSAYSNQERQRDSRRVAEIMRTSWDDNTKIKR
IQELLTIYNRMAPSLRPDERARMDRFISGYTGEIMVDGVPSQGGARRIFK
KILSPAAKSVATGFFTELGASLASILTSWFPANTERNH*
LP06769.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:49:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG24210-PA | 129 | GG24210-PA | 1..128 | 1..127 | 401 | 59.4 | Plus |
Dere\GG24221-PA | 129 | GG24221-PA | 1..128 | 1..127 | 398 | 59.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TotB-PA | 138 | CG5609-PA | 1..138 | 1..138 | 704 | 100 | Plus |
TotA-PA | 129 | CG31509-PA | 1..128 | 1..127 | 348 | 52.3 | Plus |
TotC-PA | 129 | CG31508-PA | 1..128 | 1..127 | 336 | 53.1 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:49:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA16288-PB | 154 | GA16288-PB | 34..143 | 20..122 | 215 | 40.9 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:49:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM23145-PA | 139 | GM23145-PA | 1..139 | 1..138 | 642 | 88.5 | Plus |
Dsec\GM23144-PA | 129 | GM23144-PA | 1..128 | 1..127 | 377 | 56.2 | Plus |
Dsec\GM23143-PA | 129 | GM23143-PA | 1..128 | 1..127 | 359 | 50.8 | Plus |
Dsec\GM23142-PA | 129 | GM23142-PA | 1..128 | 1..127 | 359 | 50.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:49:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD19384-PA | 139 | GD19384-PA | 1..139 | 1..138 | 652 | 89.9 | Plus |
Dsim\GD19383-PA | 129 | GD19383-PA | 1..128 | 1..127 | 377 | 56.2 | Plus |
Dsim\GD19381-PA | 129 | GD19381-PA | 1..128 | 1..127 | 364 | 52.3 | Plus |
Dsim\GD19382-PA | 129 | GD19382-PA | 1..128 | 1..127 | 359 | 50.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:49:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE25695-PA | 139 | GE25695-PA | 1..139 | 1..138 | 542 | 72.7 | Plus |
Dyak\GE18068-PA | 140 | GE18068-PA | 1..109 | 1..108 | 428 | 73.4 | Plus |
Dyak\GE25694-PA | 129 | GE25694-PA | 1..128 | 1..127 | 347 | 50.8 | Plus |