Clone LP07125 Report

Search the DGRC for LP07125

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:71
Well:25
Vector:pOT2
Associated Gene/TranscriptImpL1-RB
Protein status:LP07125.pep: gold
Preliminary Size:1296
Sequenced Size:1234

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10717 2001-01-01 Release 2 assignment
CG10717 2003-01-01 Sim4 clustering to Release 3
CG10717 2003-08-11 Blastp of sequenced clone
ImpL1 2008-04-29 Release 5.5 accounting
ImpL1 2008-08-15 Release 5.9 accounting
ImpL1 2008-12-18 5.12 accounting

Clone Sequence Records

LP07125.complete Sequence

1234 bp (1234 high quality bases) assembled on 2003-08-11

GenBank Submission: AY069742

> LP07125.complete
AGCAGCTGACCAGATCAACATGAGGCCATACCAAGTAGTTTGCATCGTAG
GTAAGTCTCGCATATCGAAGCTGACCAGTTCTGGAAGTCCCATAATTAAC
TGGTATGCGCCCATTTCCTTTTTAGCAGTAGCAGCTCTGCTGCTTTTGGA
GGCGATTCCCGCGGATGCAAAGCGGCGCAAGCACAAGGGCTCCGATCATC
ACTATGAAAAGTCTGATCCCCACAAGACCAAGACAAAGACCAAGTGGTCT
AGCTCCACGGATTTGGCTGGAAACACTCCAATTTCCACCGAAGAGCACGG
CTACTATGTAAAGCGCACCTTTGCGGCTCCCGGTGAGATTGGAGCCGCAC
AGAAGCGTCTAAGTCCCCCCTATTTGGCCATTCCCATCGCCTGGTTCAGC
TGTGAGTCGGGCCAGAAGAATTGCCAGTCTTCCAATTCCGCGGCTATCAA
CAGTGCCGCGCAGTCCTTGAGCGAGGGCTATCTGTGCGACGATGATTGCG
ATGAACTGTACGAGCCCATCTGCGGCAGGACCACCTCAGAGGTGGCCGTT
TTCTACAACAAGTGCAAGTTGGGTGTAGCCAAGTGCCGATCCCACGGTCT
TTGGACGGACTTCGCCTATGCCGAGTGCCAGGCGAAATATCCGCAGGAAA
CTGCCTATGCCGACAAGAAGTTCCGGTCATCGCCTTATTTCCGGGATGCG
GCCATCGTGGAGCAATTGAAGCTGGAGGAGGAGAAGCGTAAGCAGGAGGA
GGAACAACACAAGCTGGAGAAGGAGCAAAAGAAGAAGGAGAAGGCTGAGA
AAAATAAGAACGAGAAGGACAGCAGCGAAAGCAGCGAGGAGAAGGATGAC
CAAAAGGAAAACAAGCAGAAGGATCCCCTTTCCCTAATGCCACAGAAGAA
AGTGGAATCCACCCAGAAGCCAGTGCCAGTTCCTATTCAAGTAGCAGTTC
CAAAACCAGTTTCAGTTTTGGAGCCTGCAAAGACGACCGAGGACATCGCT
ATGCCGCCTATGCCACTGAAGGACACTCCCACGCCCAAACCTCTGGAGAT
CGCGCCCCTTCACCAGCAGACCCAACCCAAGGGCAAGGACATTGATAGGC
TCAAGTACCAAGTAGCTTAGAAAGCAATGGCTACACAAATCTCACCTAAT
TATAGTATTTATTTAATTTATTACAACAAATAAAATTCTAAACAACGATA
ATCATCTATATTTGATAAAAAAAAAAAAAAAAAA

LP07125.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:32:10
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL1-RB 1232 ImpL1-RB 17..1232 1..1216 6080 100 Plus
ImpL1-RA 1431 ImpL1-RA 234..1335 123..1224 5495 99.9 Plus
ImpL1-RC 1274 ImpL1-RC 81..1178 127..1224 5475 99.9 Plus
ImpL1-RA 1431 ImpL1-RA 187..236 1..50 250 100 Plus
ImpL1-RC 1274 ImpL1-RC 33..82 1..50 250 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13373013..13374228 1..1216 6080 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:51:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13382786..13384009 1..1224 6105 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:00:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13375886..13377109 1..1224 6105 99.9 Plus
Blast to na_te.dros performed 2019-03-15 22:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy9 5349 gypsy9 GYPSY9 5349bp 703..782 1213..1131 118 66.7 Minus
TART-C 11124 TART-C TARTC 11124bp 8767..8891 719..837 117 56.8 Plus
micropia 5461 micropia DMDM11 5461bp 3942..3996 603..551 116 72.7 Minus

LP07125.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:34:03 Download gff for LP07125.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13373013..13373735 1..723 100 == Plus
chr3L 13373886..13374228 874..1216 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:37:55 Download gff for LP07125.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RB 1..1101 20..1120 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:53:02 Download gff for LP07125.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RB 1..1101 20..1120 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:25:05 Download gff for LP07125.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RB 1..1101 20..1120 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:18:35 Download gff for LP07125.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RB 1..1101 20..1120 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:28:07 Download gff for LP07125.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RB 1..1101 20..1120 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:16:32 Download gff for LP07125.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RB 1..1214 1..1214 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:53:02 Download gff for LP07125.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RB 17..1230 1..1214 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:25:05 Download gff for LP07125.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RB 17..1230 1..1214 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:18:35 Download gff for LP07125.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RB 1..1214 1..1214 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:28:07 Download gff for LP07125.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RB 17..1230 1..1214 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:34:03 Download gff for LP07125.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13382786..13384001 1..1216 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:34:03 Download gff for LP07125.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13382786..13384001 1..1216 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:34:03 Download gff for LP07125.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13382786..13384001 1..1216 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:25:05 Download gff for LP07125.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13375886..13377101 1..1216 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:52:49 Download gff for LP07125.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13375886..13377101 1..1216 100   Plus

LP07125.hyp Sequence

Translation from 0 to 1119

> LP07125.hyp
AADQINMRPYQVVCIVGKSRISKLTSSGSPIINWYAPISFLAVAALLLLE
AIPADAKRRKHKGSDHHYEKSDPHKTKTKTKWSSSTDLAGNTPISTEEHG
YYVKRTFAAPGEIGAAQKRLSPPYLAIPIAWFSCESGQKNCQSSNSAAIN
SAAQSLSEGYLCDDDCDELYEPICGRTTSEVAVFYNKCKLGVAKCRSHGL
WTDFAYAECQAKYPQETAYADKKFRSSPYFRDAAIVEQLKLEEEKRKQEE
EQHKLEKEQKKKEKAEKNKNEKDSSESSEEKDDQKENKQKDPLSLMPQKK
VESTQKPVPVPIQVAVPKPVSVLEPAKTTEDIAMPPMPLKDTPTPKPLEI
APLHQQTQPKGKDIDRLKYQVA*

LP07125.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:24:59
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL1-PB 366 CG10717-PB 1..366 7..372 1925 100 Plus
ImpL1-PA 341 CG10717-PA 1..341 7..372 1761 93.2 Plus
ImpL1-PC 340 CG10717-PC 1..340 7..372 1756 92.9 Plus

LP07125.pep Sequence

Translation from 19 to 1119

> LP07125.pep
MRPYQVVCIVGKSRISKLTSSGSPIINWYAPISFLAVAALLLLEAIPADA
KRRKHKGSDHHYEKSDPHKTKTKTKWSSSTDLAGNTPISTEEHGYYVKRT
FAAPGEIGAAQKRLSPPYLAIPIAWFSCESGQKNCQSSNSAAINSAAQSL
SEGYLCDDDCDELYEPICGRTTSEVAVFYNKCKLGVAKCRSHGLWTDFAY
AECQAKYPQETAYADKKFRSSPYFRDAAIVEQLKLEEEKRKQEEEQHKLE
KEQKKKEKAEKNKNEKDSSESSEEKDDQKENKQKDPLSLMPQKKVESTQK
PVPVPIQVAVPKPVSVLEPAKTTEDIAMPPMPLKDTPTPKPLEIAPLHQQ
TQPKGKDIDRLKYQVA*

LP07125.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24041-PA 356 GF24041-PA 5..356 31..366 855 65.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15638-PA 343 GG15638-PA 1..343 1..366 1321 79.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:21:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17161-PA 320 GH17161-PA 1..278 1..339 728 47.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:41
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL1-PB 366 CG10717-PB 1..366 1..366 1925 100 Plus
ImpL1-PA 341 CG10717-PA 1..341 1..366 1761 93.2 Plus
ImpL1-PC 340 CG10717-PC 1..340 1..366 1756 92.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:21:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11776-PA 362 GI11776-PA 1..292 1..336 658 48.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15712-PA 323 GL15712-PA 44..323 68..366 846 59.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:21:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10517-PA 323 GA10517-PA 18..323 44..366 875 60.1 Plus
Dpse\GA29257-PA 304 GA29257-PA 18..196 44..233 651 69.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:21:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25416-PA 342 GM25416-PA 1..342 1..366 1361 88 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:21:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14446-PA 342 GD14446-PA 1..342 1..366 1355 88.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:21:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13478-PA 333 GJ13478-PA 1..277 1..334 719 50.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:21:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17441-PA 324 GK17441-PA 6..274 32..342 659 51.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:21:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21966-PA 348 GE21966-PA 1..348 1..366 1386 82 Plus