Clone LP07226 Report

Search the DGRC for LP07226

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:72
Well:26
Vector:pOT2
Associated Gene/Transcriptmge-RA
Protein status:LP07226.pep: gold
Preliminary Size:1192
Sequenced Size:1079

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14981 2001-01-01 Release 2 assignment
CG14981 2002-06-12 Blastp of sequenced clone
CG14981 2003-01-01 Sim4 clustering to Release 3
mge 2008-04-29 Release 5.5 accounting
mge 2008-08-15 Release 5.9 accounting
mge 2008-12-18 5.12 accounting

Clone Sequence Records

LP07226.complete Sequence

1079 bp (1079 high quality bases) assembled on 2002-06-12

GenBank Submission: AY122211

> LP07226.complete
CACTAAGCTCACGAGGAGCATTTTATAAAATCAATTTTTACATAAATTTT
AAGCGAACGCGAACGAATCCTCCGCTCAAGCTCAATTAAATGCCAGTGCG
AACTGGATTTTGTGAGCGATTCCGGTGATAAGATACTTCCGTGTTCCTTC
AAAGGGTTGCTTTAGAGCACAAACCCGCGATTTTCGACCGTGTGCGTTGA
TTGAAAGCCGCAAAAGTGGATACCGAAACAGTGAAAATCGAGGATTTGAT
GGACTCTGATCCTGAAATCGAGTTCATTGAAAAGGACAGCGGCATGTCGT
CGTTAGGCGGCAGCAAGGACGAGACGCCGGAGCGTCGGGCAGTGGCTGCC
ACCTCCAATGATCCGCAACGCGAGAACTACGATGATGAGCCCGATGAGAC
GGCATCCGAGCGCTTCTGGGGACTAACCGAGATGTTCCCGGAGCCAGTGA
GGAATGCAGTCGGCGCCGTGAGCAGCGCCACGGTGAAGAGCGTCAAGGGC
TTCTACTCGTTCTCGTGCAACGCCAGCTGGATATTCTTCACCAGCGCGGT
TATCCTGTTCGCCCCGGTCATCTTCGAGACGGAGCGCGCCCAGATGGAGG
AGCTGCACAAGTCGCAGCAGAAGCAGGTGCTTCTTGGACCCGGCAGTGCG
ATGGGTCCTGGAGGGCCGTCGCCCAGCTTACCCTTGATTCGTTAACCATG
AGAGACCCCCTACCACATACGCATATTAGCTCTACGATAACCGGCATCGG
AAATCCGGAAATTGCCACACGTTAGCTTAAGTTTGTCGATACCAATCAAT
CCCAGTCGAAATCGAGCGGTGCAGGACGTCCAGCGATTCCCCCCAATAAA
GCAGCCACCCATTAAATGCCACTTCACAGCGCAGCATTTACGCATCCACA
CTCTATGAACATCCGGCCCCCAAAAAAAGGACGTCCTCATCAATCGAAAC
GAGCCGTTGCAAAACTTCAGATAGGTGTTAGCATTGCAGTTGGCGTACAG
TGTATAAACAAGCAACCACTGCGGTTTAAACCAATTAATAAAACTACGTT
TATTAATAGTCAAAAAAAAAAAAAAAAAA

LP07226.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:47:22
Subject Length Description Subject Range Query Range Score Percent Strand
mge-RA 1159 mge-RA 31..1095 1..1065 5325 100 Plus
mge-RB 898 mge-RB 182..896 351..1065 3575 100 Plus
mge.a 1045 mge.a 371..1045 387..1061 3375 100 Plus
mge.a 1045 mge.a 21..370 1..350 1750 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:18:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3907309..3907982 1061..387 3310 99.7 Minus
chr3L 24539361 chr3L 3908669..3909018 350..1 1750 100 Minus
chr3L 24539361 chr3L 3908452..3908488 387..351 185 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:51:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3907853..3908531 1065..387 3395 100 Minus
3L 28110227 3L 3909221..3909570 350..1 1750 100 Minus
3L 28110227 3L 3909003..3909039 387..351 185 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:20:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3907853..3908531 1065..387 3395 100 Minus
3L 28103327 3L 3909221..3909570 350..1 1750 100 Minus
3L 28103327 3L 3909003..3909039 387..351 185 100 Minus
Blast to na_te.dros performed on 2019-03-16 12:18:40 has no hits.

LP07226.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:19:19 Download gff for LP07226.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3907309..3907982 387..1061 99 <- Minus
chr3L 3908453..3908488 351..386 100 <- Minus
chr3L 3908669..3909018 1..350 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:37:59 Download gff for LP07226.complete
Subject Subject Range Query Range Percent Splice Strand
mge-RA 1..447 249..695 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:22:11 Download gff for LP07226.complete
Subject Subject Range Query Range Percent Splice Strand
mge-RA 1..447 249..695 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:12:54 Download gff for LP07226.complete
Subject Subject Range Query Range Percent Splice Strand
mge-RA 1..447 249..695 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:12:58 Download gff for LP07226.complete
Subject Subject Range Query Range Percent Splice Strand
mge-RA 1..447 249..695 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:42:56 Download gff for LP07226.complete
Subject Subject Range Query Range Percent Splice Strand
mge-RA 1..447 249..695 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:48:43 Download gff for LP07226.complete
Subject Subject Range Query Range Percent Splice Strand
mge-RA 21..1081 1..1061 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:22:11 Download gff for LP07226.complete
Subject Subject Range Query Range Percent Splice Strand
mge-RA 21..1081 1..1061 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:12:54 Download gff for LP07226.complete
Subject Subject Range Query Range Percent Splice Strand
mge-RA 23..1083 1..1061 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:12:59 Download gff for LP07226.complete
Subject Subject Range Query Range Percent Splice Strand
mge-RA 21..1081 1..1061 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:42:56 Download gff for LP07226.complete
Subject Subject Range Query Range Percent Splice Strand
mge-RA 23..1083 1..1061 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:19:19 Download gff for LP07226.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3907857..3908531 387..1061 100 <- Minus
3L 3909004..3909039 351..386 100 <- Minus
3L 3909221..3909570 1..350 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:19:19 Download gff for LP07226.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3907857..3908531 387..1061 100 <- Minus
3L 3909004..3909039 351..386 100 <- Minus
3L 3909221..3909570 1..350 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:19:19 Download gff for LP07226.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3907857..3908531 387..1061 100 <- Minus
3L 3909004..3909039 351..386 100 <- Minus
3L 3909221..3909570 1..350 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:12:54 Download gff for LP07226.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3907857..3908531 387..1061 100 <- Minus
arm_3L 3909004..3909039 351..386 100 <- Minus
arm_3L 3909221..3909570 1..350 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:45:43 Download gff for LP07226.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3907857..3908531 387..1061 100 <- Minus
3L 3909004..3909039 351..386 100 <- Minus
3L 3909221..3909570 1..350 100   Minus

LP07226.hyp Sequence

Translation from 248 to 694

> LP07226.hyp
MDSDPEIEFIEKDSGMSSLGGSKDETPERRAVAATSNDPQRENYDDEPDE
TASERFWGLTEMFPEPVRNAVGAVSSATVKSVKGFYSFSCNASWIFFTSA
VILFAPVIFETERAQMEELHKSQQKQVLLGPGSAMGPGGPSPSLPLIR*

LP07226.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
mge-PA 148 CG14981-PA 1..148 1..148 766 100 Plus
mge-PB 122 CG14981-PB 9..122 35..148 596 100 Plus
mge-PC 52 CG14981-PC 1..46 1..46 238 100 Plus

LP07226.pep Sequence

Translation from 248 to 694

> LP07226.pep
MDSDPEIEFIEKDSGMSSLGGSKDETPERRAVAATSNDPQRENYDDEPDE
TASERFWGLTEMFPEPVRNAVGAVSSATVKSVKGFYSFSCNASWIFFTSA
VILFAPVIFETERAQMEELHKSQQKQVLLGPGSAMGPGGPSPSLPLIR*

LP07226.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:57:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10253-PA 148 GF10253-PA 1..136 1..136 631 87.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14239-PA 158 GG14239-PA 11..158 1..148 733 94.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15713-PA 152 GH15713-PA 1..152 1..148 597 75.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
mge-PA 148 CG14981-PA 1..148 1..148 766 100 Plus
mge-PB 122 CG14981-PB 9..122 35..148 596 100 Plus
mge-PC 52 CG14981-PC 1..46 1..46 238 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12768-PA 150 GI12768-PA 1..150 1..148 591 78.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16203-PA 163 GL16203-PA 1..139 1..136 534 74.1 Plus
Dper\GL24359-PA 85 GL24359-PA 11..82 40..115 197 43.4 Plus
Dper\GL19802-PA 74 GL19802-PA 6..72 44..113 147 45.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13402-PA 153 GA13402-PA 1..153 1..148 572 72.5 Plus
Dpse\GA26585-PA 85 GA26585-PA 15..82 44..115 200 48.6 Plus
Dpse\GA27201-PA 74 GA27201-PA 6..72 44..113 145 45.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14031-PA 124 GM14031-PA 7..124 31..148 602 96.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13312-PA 124 GD13312-PA 11..124 35..148 600 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16067-PA 150 GJ16067-PA 1..150 1..148 613 79.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18035-PA 155 GK18035-PA 1..155 1..148 587 75 Plus
Dwil\GK16698-PA 124 GK16698-PA 6..124 30..148 432 65.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20667-PA 158 GE20667-PA 11..158 1..148 746 95.9 Plus