Clone LP07284 Report

Search the DGRC for LP07284

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:72
Well:84
Vector:pOT2
Associated Gene/TranscriptTsp66A-RA
Protein status:LP07284.pep: wuzgold
Preliminary Size:1311
Sequenced Size:1161

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16991 2002-01-01 Sim4 clustering to Release 2
CG16991 2002-05-09 Blastp of sequenced clone
CG16991 2003-01-01 Sim4 clustering to Release 3
Tsp66A 2008-04-29 Release 5.5 accounting
Tsp66A 2008-08-15 Release 5.9 accounting
Tsp66A 2008-12-18 5.12 accounting

Clone Sequence Records

LP07284.complete Sequence

1161 bp (1161 high quality bases) assembled on 2002-05-09

GenBank Submission: AY102696

> LP07284.complete
GATTGTTTGTTCAGGTCCTACATGATAATCGCTCTAACCGTAAATGCCCT
AATGGCGCCGCTGCTGATAGTCGGTTTTTTCTTCATATATTCGCATTTAT
GCCGCGAAATACGCATTGTAATTGTTTGTAAACATTATTTTTAAAAACAC
AGCGATTGCCAAGATTGTATTTAAATTTTACAGTATGCCACAGTACTCTT
CCTGGCAACATGGTTGCAGATGATGCTGACTATACTGTTTGCACAACAGT
ACCAAATTGTTGGAGATGTACTTCGAATATGGATGAATCGCAAGAGTTTG
GAATTCTACGAAAGTCGCTGCCAGTGCTGCGGAGTTTTGGGACCTGACGA
CTACAAGTTGGGCGATCTGAATATCCCAAAATCCTGTTACAAGAATGGCA
GTGAAAGGGATGAGGACCTGTACCGATCAGGCTGCTCCACGCGCTCCATA
AAGCCCGCGTCGCCCATCATCCATGTGATCTCCTTCGTAATTCAGTCATA
TGCATTGAGGTATTCCTTATTATCCTGTTAAGGAGCAAATCCCAACCCAC
AAGTATGTGGTCTGAGCGGGTCACCGAAAGGTTTGGTAGTGTAAAAAAGT
GACTTGCAGTTCTATTCGGATTTGGGAAGCAATCCTAAAGAACATCTCTG
AACTTTAGGGCTATTTTCCAACATTGCATGGAACTTAAGCAGCAGATTTT
CATGTGAATTGCAATTTTGGGTGCGGTTTTCAATTCACATTGTACCGGGC
ATGAGTATTGGCATTCTGGCGGGCGAGACAAATTGGATGCTGCCGGCTAT
CGTCATATTTCACGGACTGCAATCAATAACGATAAACACTTGAGTCGCAA
ATCCAATGTCCAGAATCCTGTCCAACAACGGCATGCATATGGATGAGCCA
ATAAAGAAATCAACAAAGCATGTCGGGCGATTGAAAAAGTATTGCAAATA
CCCCGGATAGCTGGGGATTCGGACACGGAATTGGACTCCAATCCGGACAA
TATGCAAATGCAGCTAAGCAGAAAATATTCAAGGACGATCCAGCCCCACC
CCCTTCAACAAACGCTCAAGTTTATATATTCATTTTGTGTCCCTCGTCCC
GCGCATAAATTTTATTGTTGTCAACATTAAATTCTAGTCGTGAAAAAAAA
AAAAAAAAAAA

LP07284.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp66A-RA 1151 Tsp66A-RA 1..1147 1..1147 5735 100 Plus
Tsp66A.a 1028 Tsp66A.a 68..1028 182..1142 4805 100 Plus
Tsp66A-RC 1353 Tsp66A-RC 697..1350 494..1147 3270 100 Plus
Tsp66A-RC 1353 Tsp66A-RC 377..689 184..496 1565 100 Plus
Tsp66A-RC 1353 Tsp66A-RC 260..376 1..117 585 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7460281..7460929 494..1142 3185 99.4 Plus
chr3L 24539361 chr3L 7459668..7459985 1..318 1590 100 Plus
chr3L 24539361 chr3L 7460047..7460223 319..495 885 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:51:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7468154..7468807 494..1147 3270 100 Plus
3L 28110227 3L 7467541..7467858 1..318 1590 100 Plus
3L 28110227 3L 7467920..7468096 319..495 885 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7461254..7461907 494..1147 3270 100 Plus
3L 28103327 3L 7460641..7460958 1..318 1590 100 Plus
3L 28103327 3L 7461020..7461196 319..495 885 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:18:39 has no hits.

LP07284.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:19:39 Download gff for LP07284.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7460047..7460223 319..495 100 -> Plus
chr3L 7459668..7459985 1..318 100 -> Plus
chr3L 7460283..7460929 496..1142 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:38:05 Download gff for LP07284.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RC 166..282 1..117 100 == Plus
Tsp66A-RC 283..711 184..602 97   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:52:58 Download gff for LP07284.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RC 283..711 184..602 97   Plus
Tsp66A-RC 166..282 1..117 100 == Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:12:13 Download gff for LP07284.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RE 166..279 1..114 100 == Plus
Tsp66A-RE 280..717 175..602 96   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:45:31 Download gff for LP07284.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RC 166..282 1..117 100 == Plus
Tsp66A-RC 283..711 184..602 97   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:04:47 Download gff for LP07284.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RE 166..279 1..114 100 == Plus
Tsp66A-RE 280..717 175..602 96   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:31:17 Download gff for LP07284.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RA 1..1142 1..1142 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:52:58 Download gff for LP07284.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RA 1..1142 1..1142 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:12:13 Download gff for LP07284.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RA 1..1142 1..1142 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:45:32 Download gff for LP07284.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RA 1..1142 1..1142 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:04:47 Download gff for LP07284.complete
Subject Subject Range Query Range Percent Splice Strand
CG42660-RB 1440..2591 1..1142 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:19:39 Download gff for LP07284.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7467541..7467858 1..318 100 -> Plus
3L 7467920..7468096 319..495 100 -> Plus
3L 7468156..7468802 496..1142 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:19:39 Download gff for LP07284.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7467541..7467858 1..318 100 -> Plus
3L 7467920..7468096 319..495 100 -> Plus
3L 7468156..7468802 496..1142 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:19:39 Download gff for LP07284.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7467541..7467858 1..318 100 -> Plus
3L 7467920..7468096 319..495 100 -> Plus
3L 7468156..7468802 496..1142 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:12:13 Download gff for LP07284.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7460641..7460958 1..318 100 -> Plus
arm_3L 7461020..7461196 319..495 100 -> Plus
arm_3L 7461256..7461902 496..1142 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:17:59 Download gff for LP07284.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7460641..7460958 1..318 100 -> Plus
3L 7461020..7461196 319..495 100 -> Plus
3L 7461256..7461902 496..1142 100   Plus

LP07284.hyp Sequence

Translation from 219 to 530

> LP07284.hyp
MMLTILFAQQYQIVGDVLRIWMNRKSLEFYESRCQCCGVLGPDDYKLGDL
NIPKSCYKNGSERDEDLYRSGCSTRSIKPASPIIHVISFVIQSYALRYSL
LSC*

LP07284.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp66A-PC 236 CG16991-PC 107..204 1..103 493 92.2 Plus
Tsp66A-PD 236 CG16991-PD 107..204 1..103 493 92.2 Plus
Tsp66A-PE 238 CG16991-PE 109..206 1..103 493 92.2 Plus
Tsp66A-PF 234 CG16991-PF 107..202 1..103 466 90.3 Plus

LP07284.pep Sequence

Translation from 219 to 530

> LP07284.pep
MMLTILFAQQYQIVGDVLRIWMNRKSLEFYESRCQCCGVLGPDDYKLGDL
NIPKSCYKNGSERDEDLYRSGCSTRSIKPASPIIHVISFVIQSYALRYSL
LSC*

LP07284.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20126-PA 155 GF20126-PA 58..131 1..74 177 43.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14432-PA 185 GG14432-PA 84..182 1..99 412 75.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14887-PA 188 GH14887-PA 89..172 1..83 134 33.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:55
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp66A-PC 236 CG16991-PC 107..204 1..103 493 92.2 Plus
Tsp66A-PD 236 CG16991-PD 107..204 1..103 493 92.2 Plus
Tsp66A-PE 238 CG16991-PE 109..206 1..103 493 92.2 Plus
Tsp66A-PF 234 CG16991-PF 107..202 1..103 466 90.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12864-PA 200 GI12864-PA 74..145 1..72 154 37.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26485-PA 210 GL26485-PA 82..182 1..101 215 37.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14262-PA 195 GA14262-PA 67..167 1..101 216 39.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14847-PA 188 GM14847-PA 86..188 1..103 510 92.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14019-PA 205 GD14019-PA 103..205 1..103 494 90.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13006-PA 169 GJ13006-PA 35..110 1..76 166 35.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17386-PA 113 GK17386-PA 20..111 2..92 179 37 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21621-PA 211 GE21621-PA 82..173 1..92 400 79.3 Plus