Clone LP07287 Report

Search the DGRC for LP07287

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:72
Well:87
Vector:pOT2
Associated Gene/TranscriptCG14894-RA
Protein status:LP07287.pep: gold
Sequenced Size:957

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14894 2003-01-01 Sim4 clustering to Release 3
CG14894 2008-04-29 Release 5.5 accounting
CG14894 2008-08-15 Release 5.9 accounting
CG14894 2008-12-18 5.12 accounting

Clone Sequence Records

LP07287.complete Sequence

957 bp (957 high quality bases) assembled on 2004-12-02

GenBank Submission: BT021369

> LP07287.complete
GTTAGCATGAGGAGCTTTATTTGTTGCTGAACAACAAACCGAAATCTCCA
GTAAATTCGGTAAGGATCAATTTTAAAAAGAATGGCAGGCAACGCCAACA
GTGACGACGAATTCCATGATGCGATCGGGGAGGAGATAACCGAAAAAGAG
GCCACCAGCACGCGGCAGAGCGAAAAGGACGTGGATGAGATCGTGGAGAA
GCAAAACCAGCTGGCGTTGGATGACGAAGCGGAACAGGGCGCGGCTGGTG
GAGATTCCATCGCGACACCAACGACAGTGGACTCTGAGCTAACCATTGAG
GAGTTGCGCGAACGGGAGAAGGATCTCAGCCCAGAGCAGCTGACAGCTAA
CAAAGAAAAGGCCGATAAGCTGAAAGTTGAGGGCAACGAGTTGTTCAAAA
ATGACGACGCCGAAGGCGCCGCCAAGACCTACACAGAAGCCTTAGACATT
TGCCCCTCGGCCAGCTCCAAGGAGCGAGCAGTTCTCTACGGAAACAGGGC
TGCTGCCAAGATTAAGCTGGAGGCCAACAAAGCGGCCATCGACGACTGCA
CAAAGGCTATAGAACTGTGGCCGGAGTATGTGAGGGTGCTTTTAAGGCGC
GCCAAGCTCTATGAGCAAGAAGACAAGCCCGACGAGGCTCTGGAGGACTA
CAAAAAAGTTACTGAGATCGATCCCGGTCAGCAGGAGGCTCGCGAGGCTC
AGATTCGGCTGCCGCCAATTATAAACGAGCGCAACGAGAAGCTCAAAAAC
GAGATGATGTCCAGCTTAAAGGACCTGGGCAACATGATACTCAAACCGTT
CGGACTGTCTACACAGAATTTCCAAATGCAACAGGATCCCAACACGGGCT
CGTATTCCATCAACTTTAAATAAAAACCTAGCTAGCTAATGCTCTGCAGA
TCAACAAATAAAGCCGTATTCGTGGATGATGTGTAAAATAAAAAAAAAAA
AAAAAAA

LP07287.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:52:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG14894.b 1144 CG14894.b 43..983 1..941 4705 100 Plus
CG14894-RA 1184 CG14894-RA 76..1016 1..941 4705 100 Plus
CG14894.a 1063 CG14894.a 17..592 1..576 2880 100 Plus
CG14894.a 1063 CG14894.a 592..936 597..941 1725 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12267095..12267691 597..1 2955 99.7 Minus
chr3R 27901430 chr3R 12266699..12267043 939..595 1725 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:51:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:38:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16442402..16442998 597..1 2985 100 Minus
3R 32079331 3R 16442004..16442350 941..595 1735 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:41:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16183233..16183829 597..1 2985 100 Minus
3R 31820162 3R 16182835..16183181 941..595 1735 100 Minus
Blast to na_te.dros performed on 2019-03-16 11:38:22 has no hits.

LP07287.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:39:14 Download gff for LP07287.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12266699..12267041 597..939 100 <- Minus
chr3R 12267096..12267691 1..596 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:38:06 Download gff for LP07287.complete
Subject Subject Range Query Range Percent Splice Strand
CG14894-RA 1..792 82..873 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:24:19 Download gff for LP07287.complete
Subject Subject Range Query Range Percent Splice Strand
CG14894-RA 1..792 82..873 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:07:08 Download gff for LP07287.complete
Subject Subject Range Query Range Percent Splice Strand
CG14894-RA 1..792 82..873 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:08:32 Download gff for LP07287.complete
Subject Subject Range Query Range Percent Splice Strand
CG14894-RA 1..792 82..873 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:22:42 Download gff for LP07287.complete
Subject Subject Range Query Range Percent Splice Strand
CG14894-RA 1..792 82..873 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:26:18 Download gff for LP07287.complete
Subject Subject Range Query Range Percent Splice Strand
CG14894-RA 10..948 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:24:19 Download gff for LP07287.complete
Subject Subject Range Query Range Percent Splice Strand
CG14894-RA 10..948 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:07:08 Download gff for LP07287.complete
Subject Subject Range Query Range Percent Splice Strand
CG14894-RA 10..948 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:08:33 Download gff for LP07287.complete
Subject Subject Range Query Range Percent Splice Strand
CG14894-RA 10..948 1..939 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:22:42 Download gff for LP07287.complete
Subject Subject Range Query Range Percent Splice Strand
CG14894-RA 10..948 1..939 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:39:14 Download gff for LP07287.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16442006..16442348 597..939 100 <- Minus
3R 16442403..16442998 1..596 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:39:14 Download gff for LP07287.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16442006..16442348 597..939 100 <- Minus
3R 16442403..16442998 1..596 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:39:14 Download gff for LP07287.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16442006..16442348 597..939 100 <- Minus
3R 16442403..16442998 1..596 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:07:08 Download gff for LP07287.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12267728..12268070 597..939 100 <- Minus
arm_3R 12268125..12268720 1..596 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:44:47 Download gff for LP07287.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16182837..16183179 597..939 100 <- Minus
3R 16183234..16183829 1..596 100   Minus

LP07287.pep Sequence

Translation from 81 to 872

> LP07287.pep
MAGNANSDDEFHDAIGEEITEKEATSTRQSEKDVDEIVEKQNQLALDDEA
EQGAAGGDSIATPTTVDSELTIEELREREKDLSPEQLTANKEKADKLKVE
GNELFKNDDAEGAAKTYTEALDICPSASSKERAVLYGNRAAAKIKLEANK
AAIDDCTKAIELWPEYVRVLLRRAKLYEQEDKPDEALEDYKKVTEIDPGQ
QEAREAQIRLPPIINERNEKLKNEMMSSLKDLGNMILKPFGLSTQNFQMQ
QDPNTGSYSINFK*

LP07287.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:05:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16515-PA 266 GF16515-PA 5..261 6..262 1034 74.3 Plus
Dana\GF17806-PA 946 GF17806-PA 5..133 87..217 173 34.4 Plus
Dana\GF20636-PA 489 GF20636-PA 316..463 101..255 154 34.4 Plus
Dana\GF15495-PA 596 GF15495-PA 72..192 64..189 151 35.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:05:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19960-PA 267 GG19960-PA 1..262 1..262 1295 94.7 Plus
Dere\GG14374-PA 947 GG14374-PA 13..135 94..218 171 36 Plus
Dere\GG24711-PA 490 GG24711-PA 306..464 90..255 170 35.1 Plus
Dere\GG10284-PA 590 GG10284-PA 82..185 85..189 146 33.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:05:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18243-PA 281 GH18243-PA 1..276 1..262 888 64.9 Plus
Dgri\GH17296-PA 948 GH17296-PA 21..158 100..233 192 37.1 Plus
Dgri\GH19976-PA 420 GH19976-PA 76..222 53..221 159 31.4 Plus
Dgri\GH13778-PA 599 GH13778-PA 77..197 64..189 151 34.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG14894-PB 263 CG14894-PB 1..263 1..263 1331 100 Plus
CG14894-PA 263 CG14894-PA 1..263 1..263 1331 100 Plus
Stip1-PA 490 CG2720-PA 289..463 75..254 187 34.7 Plus
unc-45-PB 947 CG2708-PB 4..137 88..220 186 35.3 Plus
unc-45-PA 947 CG2708-PA 4..137 88..220 186 35.3 Plus
Tom70-PC 589 CG6756-PC 61..185 65..189 173 29.6 Plus
Tom70-PB 589 CG6756-PB 61..185 65..189 173 29.6 Plus
Tom70-PA 589 CG6756-PA 61..185 65..189 173 29.6 Plus
CG18472-PA 469 CG18472-PA 211..347 73..216 161 31 Plus
Sgt-PB 331 CG5094-PB 74..251 47..239 150 27.2 Plus
Sgt-PA 331 CG5094-PA 74..251 47..239 150 27.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10199-PA 281 GI10199-PA 1..276 1..262 858 64.6 Plus
Dmoj\GI10261-PA 954 GI10261-PA 25..146 100..220 185 38.7 Plus
Dmoj\GI17037-PA 490 GI17037-PA 309..464 93..255 158 33.9 Plus
Dmoj\GI20263-PA 543 GI20263-PA 91..224 79..221 154 33.6 Plus
Dmoj\GI17182-PA 598 GI17182-PA 69..193 65..189 152 29.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22240-PA 274 GL22240-PA 1..269 1..262 1032 75.5 Plus
Dper\GL21482-PA 946 GL21482-PA 18..156 100..244 204 37.2 Plus
Dper\GL25924-PA 531 GL25924-PA 301..462 86..254 174 34.5 Plus
Dper\GL14152-PA 586 GL14152-PA 64..184 64..189 146 33.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:05:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13331-PA 274 GA13331-PA 1..269 1..262 1026 75.1 Plus
Dpse\GA15439-PA 946 GA15439-PA 18..148 100..225 199 37.6 Plus
Dpse\GA15447-PA 489 GA15447-PA 301..463 86..255 173 34.3 Plus
Dpse\GA23692-PA 542 GA23692-PA 44..124 94..174 147 38.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:05:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15432-PA 267 GM15432-PA 1..262 1..262 1285 93.1 Plus
Dsec\GM10996-PA 947 GM10996-PA 13..137 94..220 175 35.4 Plus
Dsec\GM16733-PA 490 GM16733-PA 306..463 90..254 170 35.3 Plus
Dsec\GM15022-PA 214 GM15022-PA 30..187 90..254 167 35.3 Plus
Dsec\GM26429-PA 589 GM26429-PA 82..185 85..189 155 35.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20288-PA 267 GD20288-PA 1..262 1..262 1303 94.7 Plus
Dsim\GD19966-PA 947 GD19966-PA 13..137 94..220 174 35.4 Plus
Dsim\Hop-PA 490 GD23015-PA 306..463 90..254 169 35.3 Plus
Dsim\GD22142-PA 589 GD22142-PA 82..185 85..189 155 35.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:05:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23487-PA 283 GJ23487-PA 1..278 1..262 839 64.5 Plus
Dvir\GJ11067-PA 947 GJ11067-PA 18..132 100..216 186 38.5 Plus
Dvir\GJ24688-PA 490 GJ24688-PA 309..464 93..255 163 34.5 Plus
Dvir\GJ22149-PA 597 GJ22149-PA 72..192 64..189 151 34.1 Plus
Dvir\GJ20216-PA 536 GJ20216-PA 77..226 53..224 148 29.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:05:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14066-PA 277 GK14066-PA 1..272 1..262 974 70.2 Plus
Dwil\GK13474-PA 949 GK13474-PA 5..138 87..220 183 35.1 Plus
Dwil\GK18373-PA 492 GK18373-PA 311..466 93..255 166 35.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:05:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26312-PA 260 GE26312-PA 1..255 1..262 1260 93.5 Plus
Dyak\GE24964-PA 947 GE24964-PA 19..135 100..218 174 37 Plus
Dyak\Hop-PA 490 GE16725-PA 306..463 90..254 170 35.3 Plus
Dyak\GE12794-PA 332 GE12794-PA 77..289 54..254 154 28.4 Plus
Dyak\GE12522-PA 590 GE12522-PA 82..185 85..189 151 34.3 Plus

LP07287.hyp Sequence

Translation from 81 to 872

> LP07287.hyp
MAGNANSDDEFHDAIGEEITEKEATSTRQSEKDVDEIVEKQNQLALDDEA
EQGAAGGDSIATPTTVDSELTIEELREREKDLSPEQLTANKEKADKLKVE
GNELFKNDDAEGAAKTYTEALDICPSASSKERAVLYGNRAAAKIKLEANK
AAIDDCTKAIELWPEYVRVLLRRAKLYEQEDKPDEALEDYKKVTEIDPGQ
QEAREAQIRLPPIINERNEKLKNEMMSSLKDLGNMILKPFGLSTQNFQMQ
QDPNTGSYSINFK*

LP07287.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:01:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG14894-PB 263 CG14894-PB 1..263 1..263 1331 100 Plus
CG14894-PA 263 CG14894-PA 1..263 1..263 1331 100 Plus
Hop-PA 490 CG2720-PA 289..463 75..254 187 34.7 Plus
unc-45-PA 947 CG2708-PA 4..137 88..220 186 35.3 Plus
Tom70-PC 589 CG6756-PC 61..185 65..189 173 29.6 Plus