Clone LP07417 Report

Search the DGRC for LP07417

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:74
Well:17
Vector:pOT2
Associated Gene/TranscriptCG13365-RA
Protein status:LP07417.pep: gold
Preliminary Size:494
Sequenced Size:514

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13365 2002-01-01 Sim4 clustering to Release 2
CG13365 2002-05-18 Blastp of sequenced clone
CG13365 2003-01-01 Sim4 clustering to Release 3
CG13365 2008-04-29 Release 5.5 accounting
CG13365 2008-08-15 Release 5.9 accounting
CG13365 2008-12-18 5.12 accounting

Clone Sequence Records

LP07417.complete Sequence

514 bp (514 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119061

> LP07417.complete
TCGCTTGTTTACATTTTGCATCTTTACATAACGAACTTAGTTATAGCAGC
ACATAAGCACACAATGGCACTGTTCGAGATGAAGTGGCTGCGCCGCTGGG
TGCGGCGCAACACGAATCCCATACCGGAGCACCGGGCGGAGCTGTGGAAG
CGGCGCCTGAGCATCGGGTACGCCGTTCTGGCCTGGCAGGCATTCGGCCT
CGTTTGCTATATGGTCTACACCGGACGCAACGACTGGGCCAAGTACTACG
GCTACAAGACGGAGGAGGAGATGGCCCTTTCGCCGGCCCAACAGTTCGCC
AAGCACCTGAAGGTCGAGGGGACCGGCAAGATCATCAGGTTCTCTGGATT
CCACAAGGTGGAGGAGGTGCCCTTCGACGCCAGCGAGGTGGAGCGGGTCA
AGGAGTAACTGTAGTTCCCACCAGCTCAGTGAACCATTATTTTTTTTTAG
CCATCGTATGTTTATTGCCATTAAAGCTTACAAATAGGACTTAAAAAAAA
AAAAAAAAAAAAAA

LP07417.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:01:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG13365-RA 494 CG13365-RA 1..494 1..494 2470 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 514711..515201 492..1 2410 99.8 Minus
chrX 22417052 chrX 514395..514592 425..228 765 92.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:51:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 620715..621208 494..1 2470 100 Minus
X 23542271 X 620401..620598 425..228 765 92.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:33:21
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 628813..629306 494..1 2470 100 Minus
X 23527363 X 628499..628696 425..228 765 92.4 Minus
Blast to na_te.dros performed on 2019-03-16 18:18:25 has no hits.

LP07417.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:19:05 Download gff for LP07417.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 514711..515201 1..492 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:38:20 Download gff for LP07417.complete
Subject Subject Range Query Range Percent Splice Strand
CG13365-RA 1..345 64..408 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:42:13 Download gff for LP07417.complete
Subject Subject Range Query Range Percent Splice Strand
CG13365-RA 1..345 64..408 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:12:55 Download gff for LP07417.complete
Subject Subject Range Query Range Percent Splice Strand
CG13365-RA 1..345 64..408 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:34:20 Download gff for LP07417.complete
Subject Subject Range Query Range Percent Splice Strand
CG13365-RA 1..345 64..408 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:38:06 Download gff for LP07417.complete
Subject Subject Range Query Range Percent Splice Strand
CG13365-RA 1..345 64..408 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:16:28 Download gff for LP07417.complete
Subject Subject Range Query Range Percent Splice Strand
CG13365-RA 1..492 1..492 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:42:13 Download gff for LP07417.complete
Subject Subject Range Query Range Percent Splice Strand
CG13365-RA 1..492 1..492 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:12:55 Download gff for LP07417.complete
Subject Subject Range Query Range Percent Splice Strand
CG13365-RA 8..499 1..492 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:34:21 Download gff for LP07417.complete
Subject Subject Range Query Range Percent Splice Strand
CG13365-RA 1..492 1..492 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:38:06 Download gff for LP07417.complete
Subject Subject Range Query Range Percent Splice Strand
CG13365-RA 8..499 1..492 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:19:05 Download gff for LP07417.complete
Subject Subject Range Query Range Percent Splice Strand
X 620717..621208 1..492 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:19:05 Download gff for LP07417.complete
Subject Subject Range Query Range Percent Splice Strand
X 620717..621208 1..492 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:19:05 Download gff for LP07417.complete
Subject Subject Range Query Range Percent Splice Strand
X 620717..621208 1..492 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:12:55 Download gff for LP07417.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 514750..515241 1..492 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:06:40 Download gff for LP07417.complete
Subject Subject Range Query Range Percent Splice Strand
X 628815..629306 1..492 100   Minus

LP07417.hyp Sequence

Translation from 0 to 407

> LP07417.hyp
SLVYILHLYITNLVIAAHKHTMALFEMKWLRRWVRRNTNPIPEHRAELWK
RRLSIGYAVLAWQAFGLVCYMVYTGRNDWAKYYGYKTEEEMALSPAQQFA
KHLKVEGTGKIIRFSGFHKVEEVPFDASEVERVKE*

LP07417.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG13365-PA 114 CG13365-PA 1..114 22..135 616 100 Plus

LP07417.pep Sequence

Translation from 63 to 407

> LP07417.pep
MALFEMKWLRRWVRRNTNPIPEHRAELWKRRLSIGYAVLAWQAFGLVCYM
VYTGRNDWAKYYGYKTEEEMALSPAQQFAKHLKVEGTGKIIRFSGFHKVE
EVPFDASEVERVKE*

LP07417.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22062-PA 114 GF22062-PA 1..114 1..114 547 86.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12753-PA 114 GG12753-PA 1..114 1..114 579 93 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24632-PA 114 GH24632-PA 1..114 1..114 553 86 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG13365-PA 114 CG13365-PA 1..114 1..114 616 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15821-PA 114 GI15821-PA 1..114 1..114 537 83.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21393-PA 109 GL21393-PA 1..109 6..114 526 88.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12233-PA 114 GA12233-PA 1..114 1..114 560 89.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19033-PA 114 GM19033-PA 1..114 1..114 598 97.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16471-PA 114 GD16471-PA 1..114 1..114 601 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18672-PA 114 GJ18672-PA 1..114 1..114 540 84.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16172-PA 114 GK16172-PA 1..114 1..114 526 82.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16578-PA 114 GE16578-PA 1..114 1..114 595 96.5 Plus