BDGP Sequence Production Resources |
Search the DGRC for LP07417
Library: | LP |
Tissue Source: | Drosophila melanogaster larval-early pupal |
Created by: | Ling Hong |
Date Registered: | 1998-06-11 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 74 |
Well: | 17 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13365-RA |
Protein status: | LP07417.pep: gold |
Preliminary Size: | 494 |
Sequenced Size: | 514 |
Gene | Date | Evidence |
---|---|---|
CG13365 | 2002-01-01 | Sim4 clustering to Release 2 |
CG13365 | 2002-05-18 | Blastp of sequenced clone |
CG13365 | 2003-01-01 | Sim4 clustering to Release 3 |
CG13365 | 2008-04-29 | Release 5.5 accounting |
CG13365 | 2008-08-15 | Release 5.9 accounting |
CG13365 | 2008-12-18 | 5.12 accounting |
514 bp (514 high quality bases) assembled on 2002-05-18
GenBank Submission: AY119061
> LP07417.complete TCGCTTGTTTACATTTTGCATCTTTACATAACGAACTTAGTTATAGCAGC ACATAAGCACACAATGGCACTGTTCGAGATGAAGTGGCTGCGCCGCTGGG TGCGGCGCAACACGAATCCCATACCGGAGCACCGGGCGGAGCTGTGGAAG CGGCGCCTGAGCATCGGGTACGCCGTTCTGGCCTGGCAGGCATTCGGCCT CGTTTGCTATATGGTCTACACCGGACGCAACGACTGGGCCAAGTACTACG GCTACAAGACGGAGGAGGAGATGGCCCTTTCGCCGGCCCAACAGTTCGCC AAGCACCTGAAGGTCGAGGGGACCGGCAAGATCATCAGGTTCTCTGGATT CCACAAGGTGGAGGAGGTGCCCTTCGACGCCAGCGAGGTGGAGCGGGTCA AGGAGTAACTGTAGTTCCCACCAGCTCAGTGAACCATTATTTTTTTTTAG CCATCGTATGTTTATTGCCATTAAAGCTTACAAATAGGACTTAAAAAAAA AAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13365-RA | 494 | CG13365-RA | 1..494 | 1..494 | 2470 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 514711..515201 | 1..492 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13365-RA | 1..345 | 64..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13365-RA | 1..345 | 64..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13365-RA | 1..345 | 64..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13365-RA | 1..345 | 64..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13365-RA | 1..345 | 64..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13365-RA | 1..492 | 1..492 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13365-RA | 1..492 | 1..492 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13365-RA | 8..499 | 1..492 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13365-RA | 1..492 | 1..492 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13365-RA | 8..499 | 1..492 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 620717..621208 | 1..492 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 620717..621208 | 1..492 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 620717..621208 | 1..492 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 514750..515241 | 1..492 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 628815..629306 | 1..492 | 100 | Minus |
Translation from 0 to 407
> LP07417.hyp SLVYILHLYITNLVIAAHKHTMALFEMKWLRRWVRRNTNPIPEHRAELWK RRLSIGYAVLAWQAFGLVCYMVYTGRNDWAKYYGYKTEEEMALSPAQQFA KHLKVEGTGKIIRFSGFHKVEEVPFDASEVERVKE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13365-PA | 114 | CG13365-PA | 1..114 | 22..135 | 616 | 100 | Plus |
Translation from 63 to 407
> LP07417.pep MALFEMKWLRRWVRRNTNPIPEHRAELWKRRLSIGYAVLAWQAFGLVCYM VYTGRNDWAKYYGYKTEEEMALSPAQQFAKHLKVEGTGKIIRFSGFHKVE EVPFDASEVERVKE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF22062-PA | 114 | GF22062-PA | 1..114 | 1..114 | 547 | 86.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG12753-PA | 114 | GG12753-PA | 1..114 | 1..114 | 579 | 93 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24632-PA | 114 | GH24632-PA | 1..114 | 1..114 | 553 | 86 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13365-PA | 114 | CG13365-PA | 1..114 | 1..114 | 616 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI15821-PA | 114 | GI15821-PA | 1..114 | 1..114 | 537 | 83.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21393-PA | 109 | GL21393-PA | 1..109 | 6..114 | 526 | 88.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12233-PA | 114 | GA12233-PA | 1..114 | 1..114 | 560 | 89.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM19033-PA | 114 | GM19033-PA | 1..114 | 1..114 | 598 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD16471-PA | 114 | GD16471-PA | 1..114 | 1..114 | 601 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18672-PA | 114 | GJ18672-PA | 1..114 | 1..114 | 540 | 84.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16172-PA | 114 | GK16172-PA | 1..114 | 1..114 | 526 | 82.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE16578-PA | 114 | GE16578-PA | 1..114 | 1..114 | 595 | 96.5 | Plus |