Clone LP07538 Report

Search the DGRC for LP07538

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:75
Well:38
Vector:pOT2
Associated Gene/TranscriptCG17834-RB
Protein status:LP07538.pep: gold
Preliminary Size:1285
Sequenced Size:1170

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17834 2001-01-01 Release 2 assignment
CG17834 2002-05-17 Blastp of sequenced clone
CG17834 2003-01-01 Sim4 clustering to Release 3
CG17834 2008-04-29 Release 5.5 accounting
CG17834 2008-08-15 Release 5.9 accounting
CG17834 2008-12-18 5.12 accounting

Clone Sequence Records

LP07538.complete Sequence

1170 bp (1170 high quality bases) assembled on 2002-05-17

GenBank Submission: AY119062

> LP07538.complete
AAAAATTTCTGGAACGAGTCACACGCACCGCACGTTCCTCCGCAGAAAGA
AATCATAAATTAATCAAAGCATTGTTACAACACAACAACGATTTTCGGAC
TCGGATTCTCTTCATTTTTTATTCGAGCGGAGAGTAAATAAAGTCAAGAA
AACAAGAGGAAGAGGAAGAGCGGTAGGGAGCCAACAACAAAATGTGCCGC
TGCTGTCAAAACTGCTGGGAAGATTTCTACTGGAATTGCTTCGAGGAGCG
TTTCTGCTACGACGAATCCATCGCCAACTACAATCCCGAGGAGGACGAGG
ACTACTTGGCGTCCAGGAAAAATGGCCAGATCATTGGACGCATACAACCG
ACATCGGTGGATAATAATAATTCGCTGACGGTGCCCCAACCGATTTGCGA
TCAGCCGCAAATGAGGCAGGGCAACTCGAGCTTGGGCCTGAGCCTAATGA
GCGCCAAGATCCACGAGGAGGACTATCGTCGGGAGACACAGATCAATGTG
CCCAACCTGGGACCGGAGATACTGGCGGTTTTTGCCAATTCGCAAATCTT
CCAGGACCATCAGCCCACCAAGCTGAACCGGATCAGCACCAAGACCTATC
TGGCCGGAATCCATTCGCCGAATCGCGAAATGCCGACAACTCCGCGGCTC
AGCGATCAGGATCGATTGCTGCGACGTCTGGAAGGTAATGATGGCCCCAG
TGGTGCACACACCCCACTTTTGGGTGGTGCTGCTAATGGTAAAAGCAGCG
GCAAGAGCACCCGCAGCAGCAGCATCGTATCCAGCGGTGTGCCCAAGGTC
AAGTTCTATCTGAACTGAACATCGATGGGTTTTGGGGTTCAATGGGTACT
AGCAGTATTTGTGCCAAAGATTGAGGAACTCTCGCAATGCGGATATAATC
AATTGGAGAGTGACCAATATCGCCAAAATGTGACTTAATATTATTAACTA
ATTAGCTGTAAGTGTTGCTACACAATATTCGATAGAGACAGCAATGCCAG
TGCGACTGGCATTTAGTATTATCTATACTCCTAAGTAGCCTAATTTAAGT
TAGCTTAAACGTTTACCATTTAAGTCTTAATTGTTGGACCTTGTAATTGT
TTAGTCCTAAGCGACAAAGAGCAAACAGTATGATTTTCATAAAGTTTTTA
AACAAAAAAAAAAAAAAAAA

LP07538.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG17834-RD 1157 CG17834-RD 1..1157 1..1157 5785 100 Plus
CG17834-RB 1229 CG17834-RB 120..1229 48..1157 5550 100 Plus
CG17834.c 1173 CG17834.c 65..1173 45..1153 5545 100 Plus
CG17834-RB 1229 CG17834-RB 1..49 1..49 245 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:11:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8536122..8536825 450..1153 3475 99.6 Plus
chr2L 23010047 chr2L 8535786..8535964 273..451 895 100 Plus
chr2L 23010047 chr2L 8534809..8534972 48..211 820 100 Plus
chr2L 23010047 chr2L 8535100..8535161 212..273 310 100 Plus
chr2L 23010047 chr2L 8534690..8534738 1..49 245 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:52:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:11:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8537229..8537936 450..1157 3540 100 Plus
2L 23513712 2L 8536893..8537071 273..451 895 100 Plus
2L 23513712 2L 8535916..8536079 48..211 820 100 Plus
2L 23513712 2L 8536207..8536268 212..273 310 100 Plus
2L 23513712 2L 8535797..8535845 1..49 245 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8537229..8537936 450..1157 3540 100 Plus
2L 23513712 2L 8536893..8537071 273..451 895 100 Plus
2L 23513712 2L 8535916..8536079 48..211 820 100 Plus
2L 23513712 2L 8536207..8536268 212..273 310 100 Plus
2L 23513712 2L 8535797..8535845 1..49 245 100 Plus
Blast to na_te.dros performed 2019-03-16 22:11:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6732..6767 741..776 117 80.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6753..6788 741..776 117 80.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6774..6809 741..776 117 80.6 Plus
roo 9092 roo DM_ROO 9092bp 1107..1148 735..776 111 73.8 Plus

LP07538.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:12:23 Download gff for LP07538.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8535787..8535964 274..451 100 -> Plus
chr2L 8534690..8534738 1..49 100 -> Plus
chr2L 8534811..8534972 50..211 100 -> Plus
chr2L 8535100..8535161 212..273 100 -> Plus
chr2L 8536124..8536825 452..1153 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:38:26 Download gff for LP07538.complete
Subject Subject Range Query Range Percent Splice Strand
CG17834-RD 1..627 192..818 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:48:19 Download gff for LP07538.complete
Subject Subject Range Query Range Percent Splice Strand
CG17834-RD 1..627 192..818 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:12:19 Download gff for LP07538.complete
Subject Subject Range Query Range Percent Splice Strand
CG17834-RB 1..627 192..818 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:40:53 Download gff for LP07538.complete
Subject Subject Range Query Range Percent Splice Strand
CG17834-RD 1..627 192..818 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:36:43 Download gff for LP07538.complete
Subject Subject Range Query Range Percent Splice Strand
CG17834-RB 1..627 192..818 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:24:54 Download gff for LP07538.complete
Subject Subject Range Query Range Percent Splice Strand
CG17834-RD 1..1153 1..1153 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:48:19 Download gff for LP07538.complete
Subject Subject Range Query Range Percent Splice Strand
CG17834-RD 1..1153 1..1153 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:12:19 Download gff for LP07538.complete
Subject Subject Range Query Range Percent Splice Strand
CG17834-RD 12..1164 1..1153 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:40:53 Download gff for LP07538.complete
Subject Subject Range Query Range Percent Splice Strand
CG17834-RD 1..1153 1..1153 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:36:43 Download gff for LP07538.complete
Subject Subject Range Query Range Percent Splice Strand
CG17834-RD 12..1164 1..1153 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:12:23 Download gff for LP07538.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8535797..8535845 1..49 100 -> Plus
2L 8535918..8536079 50..211 100 -> Plus
2L 8536207..8536268 212..273 100 -> Plus
2L 8536894..8537071 274..451 100 -> Plus
2L 8537231..8537932 452..1153 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:12:23 Download gff for LP07538.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8535797..8535845 1..49 100 -> Plus
2L 8535918..8536079 50..211 100 -> Plus
2L 8536207..8536268 212..273 100 -> Plus
2L 8536894..8537071 274..451 100 -> Plus
2L 8537231..8537932 452..1153 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:12:23 Download gff for LP07538.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8535797..8535845 1..49 100 -> Plus
2L 8535918..8536079 50..211 100 -> Plus
2L 8536207..8536268 212..273 100 -> Plus
2L 8536894..8537071 274..451 100 -> Plus
2L 8537231..8537932 452..1153 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:12:19 Download gff for LP07538.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8535797..8535845 1..49 100 -> Plus
arm_2L 8535918..8536079 50..211 100 -> Plus
arm_2L 8536207..8536268 212..273 100 -> Plus
arm_2L 8536894..8537071 274..451 100 -> Plus
arm_2L 8537231..8537932 452..1153 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:13:08 Download gff for LP07538.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8537231..8537932 452..1153 100   Plus
2L 8535797..8535845 1..49 100 -> Plus
2L 8535918..8536079 50..211 100 -> Plus
2L 8536207..8536268 212..273 100 -> Plus
2L 8536894..8537071 274..451 100 -> Plus

LP07538.pep Sequence

Translation from 191 to 817

> LP07538.pep
MCRCCQNCWEDFYWNCFEERFCYDESIANYNPEEDEDYLASRKNGQIIGR
IQPTSVDNNNSLTVPQPICDQPQMRQGNSSLGLSLMSAKIHEEDYRRETQ
INVPNLGPEILAVFANSQIFQDHQPTKLNRISTKTYLAGIHSPNREMPTT
PRLSDQDRLLRRLEGNDGPSGAHTPLLGGAANGKSSGKSTRSSSIVSSGV
PKVKFYLN*

LP07538.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:26:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15535-PA 422 GF15535-PA 1..166 1..166 878 93.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:26:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25295-PA 424 GG25295-PA 1..166 1..166 916 97.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:26:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10961-PA 405 GH10961-PA 1..172 1..174 759 79.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG17834-PF 208 CG17834-PF 1..208 1..208 1117 100 Plus
CG17834-PD 208 CG17834-PD 1..208 1..208 1117 100 Plus
CG17834-PB 208 CG17834-PB 1..208 1..208 1117 100 Plus
CG17834-PE 423 CG17834-PE 1..166 1..166 899 99.4 Plus
CG17834-PC 423 CG17834-PC 1..166 1..166 899 99.4 Plus
CG17834-PA 423 CG17834-PA 1..166 1..166 899 99.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:26:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10476-PA 196 GI10476-PA 1..196 1..208 851 76.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:27:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26135-PA 414 GL26135-PA 1..167 1..166 862 91.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:27:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14689-PA 418 GA14689-PA 1..167 1..166 863 91.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:27:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17066-PA 425 GM17066-PA 1..166 1..166 925 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23555-PA 425 GD23555-PA 1..166 1..166 925 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21692-PA 413 GJ21692-PA 1..160 1..165 706 79.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:27:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18749-PA 407 GK18749-PA 1..165 1..166 793 86.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:27:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18786-PA 426 GE18786-PA 1..166 1..166 924 98.8 Plus

LP07538.hyp Sequence

Translation from 191 to 817

> LP07538.hyp
MCRCCQNCWEDFYWNCFEERFCYDESIANYNPEEDEDYLASRKNGQIIGR
IQPTSVDNNNSLTVPQPICDQPQMRQGNSSLGLSLMSAKIHEEDYRRETQ
INVPNLGPEILAVFANSQIFQDHQPTKLNRISTKTYLAGIHSPNREMPTT
PRLSDQDRLLRRLEGNDGPSGAHTPLLGGAANGKSSGKSTRSSSIVSSGV
PKVKFYLN*

LP07538.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:22:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG17834-PF 208 CG17834-PF 1..208 1..208 1117 100 Plus
CG17834-PD 208 CG17834-PD 1..208 1..208 1117 100 Plus
CG17834-PB 208 CG17834-PB 1..208 1..208 1117 100 Plus
CG17834-PE 423 CG17834-PE 1..166 1..166 899 99.4 Plus
CG17834-PC 423 CG17834-PC 1..166 1..166 899 99.4 Plus