Clone LP07620 Report

Search the DGRC for LP07620

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:76
Well:20
Vector:pOT2
Associated Gene/TranscriptCG11852-RA
Protein status:LP07620.pep: gold
Preliminary Size:1011
Sequenced Size:1053

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11852 2002-01-01 Sim4 clustering to Release 2
CG11852 2002-05-18 Blastp of sequenced clone
CG11852 2003-01-01 Sim4 clustering to Release 3
CG11852 2008-04-29 Release 5.5 accounting
CG11852 2008-08-15 Release 5.9 accounting
CG11852 2008-12-18 5.12 accounting

Clone Sequence Records

LP07620.complete Sequence

1053 bp (1053 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119063

> LP07620.complete
ATTGAACCTGGTCGGGCATTCGCCAAATCGTCGAGCGGTTGAATTTCGGG
GCGCTTGAATTTCGTACGTAACTAGATCCATATCCAGAATGATGCTGCTC
CAGCTGGGCTGCGTGGCCCTCTTCTGCTGCTTGGTTAGCGGTGCCTCGAA
TTTCCCTCCCGAACTGCCGCGCTGCCACATGGGCGACACCAGCTGCATCA
TCAACGTGTCGCACATGCTGATCAGACAGCACGCGAGGACCGGCTATCCG
TCCGCTGGATTCCCCCAGGTGGAGCCCTTCCTGATCAAGCGCTTCGACAT
CTCCGACGGACGCACTGGCTCCCTGAATCTAAAGCTCAACTTCAGGGACG
TGAATGTGGAGGGCCTGTCCAGTGTGAAGTTCGACAGAGCCGTTGGCTTT
GGCGCTGATCCTGCAACCAGCAAGTTTGAGATGTACGGATCCTTTCCCAA
GATCGTGCTGAAGGGCAAGTACGTGGCGGATGGACGCATCCTGATCCTGC
CGATTCGTGGCGATGGCGATGCCGAGATCGTGTTGCACAATCCCAAGTTT
TCGGTGAAATTCAAGCCGGGCACACAGCAGCGCAATGGACGCACCTACCT
GAGCGTGGATAAGCTCAAGGTTCTGGTGGAGCCACAAAAGATGAACATTC
GGCTGGAGAACCTCTTTAATGGCGACCAGGCATTGGGCACCAATCTGAAT
CAGTTCCTCAACGACAACTGGACGGAGGTGTGGAACGAGCTGCATCCCTC
CATTCATGTGGCCATCGCCGAGATCATGAAGAGCGTTCTCTCGCAGCTCT
TCAAGCGCTTCGCCTACGAGGATTTATTCCTCGAGAACTGAGCACTAGTC
GTCCTAGTCGCCATCAGGCGCCCTAGGACTTTAGGCTAAGTGTACGAGTA
TTTCCTCACCTATCCAAGCTATTCTCACTCACATGGGGCGTTGCATTCCG
GCATTCCGGCCATTGACACATCATCATCGTATCATCGTATCTGCTAAGCT
AAGCTTTAACTTGTAGAATAAACAAAAACATTCGAAAAAAAAAAAAAAAA
AAA

LP07620.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:01:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG11852-RA 1216 CG11852-RA 93..1134 1..1042 5210 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:58:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21061582..21061976 640..1034 1975 100 Plus
chr3R 27901430 chr3R 21061281..21061527 394..640 1220 99.6 Plus
chr3R 27901430 chr3R 21060918..21061152 156..390 1115 98.3 Plus
chr3R 27901430 chr3R 21060706..21060860 1..155 745 98.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:52:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:58:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25238501..25238903 640..1042 2015 100 Plus
3R 32079331 3R 25238200..25238446 394..640 1235 100 Plus
3R 32079331 3R 25237837..25238074 156..393 1190 100 Plus
3R 32079331 3R 25237625..25237779 1..155 775 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:33:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24979332..24979734 640..1042 2015 100 Plus
3R 31820162 3R 24979031..24979277 394..640 1235 100 Plus
3R 31820162 3R 24978668..24978905 156..393 1190 100 Plus
3R 31820162 3R 24978456..24978610 1..155 775 100 Plus
Blast to na_te.dros performed on 2019-03-15 13:58:25 has no hits.

LP07620.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:59:30 Download gff for LP07620.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21060706..21060860 1..155 98 -> Plus
chr3R 21060918..21061155 156..393 97 -> Plus
chr3R 21061281..21061526 394..639 99 -> Plus
chr3R 21061582..21061976 640..1034 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:38:29 Download gff for LP07620.complete
Subject Subject Range Query Range Percent Splice Strand
CG11852-RA 1..753 89..841 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:42:15 Download gff for LP07620.complete
Subject Subject Range Query Range Percent Splice Strand
CG11852-RA 1..753 89..841 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:19:06 Download gff for LP07620.complete
Subject Subject Range Query Range Percent Splice Strand
CG11852-RA 1..753 89..841 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:34:22 Download gff for LP07620.complete
Subject Subject Range Query Range Percent Splice Strand
CG11852-RA 1..753 89..841 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:47:10 Download gff for LP07620.complete
Subject Subject Range Query Range Percent Splice Strand
CG11852-RA 1..753 89..841 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:16:30 Download gff for LP07620.complete
Subject Subject Range Query Range Percent Splice Strand
CG11852-RA 1..1034 1..1034 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:42:15 Download gff for LP07620.complete
Subject Subject Range Query Range Percent Splice Strand
CG11852-RA 1..1034 1..1034 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:19:06 Download gff for LP07620.complete
Subject Subject Range Query Range Percent Splice Strand
CG11852-RA 12..1045 1..1034 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:34:22 Download gff for LP07620.complete
Subject Subject Range Query Range Percent Splice Strand
CG11852-RA 1..1034 1..1034 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:47:10 Download gff for LP07620.complete
Subject Subject Range Query Range Percent Splice Strand
CG11852-RA 12..1045 1..1034 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:59:30 Download gff for LP07620.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25237837..25238074 156..393 100 -> Plus
3R 25238200..25238445 394..639 100 -> Plus
3R 25237625..25237779 1..155 100 -> Plus
3R 25238501..25238895 640..1034 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:59:30 Download gff for LP07620.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25237837..25238074 156..393 100 -> Plus
3R 25238200..25238445 394..639 100 -> Plus
3R 25237625..25237779 1..155 100 -> Plus
3R 25238501..25238895 640..1034 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:59:30 Download gff for LP07620.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25237837..25238074 156..393 100 -> Plus
3R 25238200..25238445 394..639 100 -> Plus
3R 25237625..25237779 1..155 100 -> Plus
3R 25238501..25238895 640..1034 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:19:06 Download gff for LP07620.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21063347..21063501 1..155 100 -> Plus
arm_3R 21063559..21063796 156..393 100 -> Plus
arm_3R 21063922..21064167 394..639 100 -> Plus
arm_3R 21064223..21064617 640..1034 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:06:42 Download gff for LP07620.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24978668..24978905 156..393 100 -> Plus
3R 24979031..24979276 394..639 100 -> Plus
3R 24979332..24979726 640..1034 100   Plus
3R 24978456..24978610 1..155 100 -> Plus

LP07620.hyp Sequence

Translation from 88 to 840

> LP07620.hyp
MMLLQLGCVALFCCLVSGASNFPPELPRCHMGDTSCIINVSHMLIRQHAR
TGYPSAGFPQVEPFLIKRFDISDGRTGSLNLKLNFRDVNVEGLSSVKFDR
AVGFGADPATSKFEMYGSFPKIVLKGKYVADGRILILPIRGDGDAEIVLH
NPKFSVKFKPGTQQRNGRTYLSVDKLKVLVEPQKMNIRLENLFNGDQALG
TNLNQFLNDNWTEVWNELHPSIHVAIAEIMKSVLSQLFKRFAYEDLFLEN
*

LP07620.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG11852-PA 250 CG11852-PA 1..250 1..250 1311 100 Plus
CG11854-PB 250 CG11854-PB 1..249 2..248 371 34.4 Plus
to-PB 249 CG11853-PB 1..247 3..249 341 30.6 Plus
to-PA 249 CG11853-PA 1..247 3..249 341 30.6 Plus
CG10407-PB 259 CG10407-PB 31..256 19..246 313 30 Plus

LP07620.pep Sequence

Translation from 88 to 840

> LP07620.pep
MMLLQLGCVALFCCLVSGASNFPPELPRCHMGDTSCIINVSHMLIRQHAR
TGYPSAGFPQVEPFLIKRFDISDGRTGSLNLKLNFRDVNVEGLSSVKFDR
AVGFGADPATSKFEMYGSFPKIVLKGKYVADGRILILPIRGDGDAEIVLH
NPKFSVKFKPGTQQRNGRTYLSVDKLKVLVEPQKMNIRLENLFNGDQALG
TNLNQFLNDNWTEVWNELHPSIHVAIAEIMKSVLSQLFKRFAYEDLFLEN
*

LP07620.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17552-PA 250 GF17552-PA 1..250 1..250 1178 87.6 Plus
Dana\GF17554-PA 254 GF17554-PA 1..251 2..248 382 34.4 Plus
Dana\GF17553-PA 248 GF17553-PA 9..247 11..249 357 30.8 Plus
Dana\GF11323-PA 261 GF11323-PA 58..256 45..247 307 30.5 Plus
Dana\GF18525-PA 258 GF18525-PA 5..248 8..248 304 28.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11378-PA 250 GG11378-PA 1..250 1..250 1299 96 Plus
Dere\GG11380-PA 250 GG11380-PA 1..249 2..248 373 34.7 Plus
Dere\GG11379-PA 248 GG11379-PA 1..248 3..250 343 30.1 Plus
Dere\GG14982-PA 258 GG14982-PA 6..248 9..248 324 29.8 Plus
Dere\GG20212-PA 259 GG20212-PA 31..257 23..247 311 29.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17380-PA 248 GH17380-PA 14..248 16..250 1089 83.8 Plus
Dgri\GH17381-PA 246 GH17381-PA 3..246 5..249 418 30.6 Plus
Dgri\GH17382-PA 259 GH17382-PA 22..250 19..247 344 33.6 Plus
Dgri\GH14735-PA 237 GH14735-PA 7..237 9..249 340 27 Plus
Dgri\GH18842-PA 260 GH18842-PA 57..255 45..247 321 31 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG11852-PA 250 CG11852-PA 1..250 1..250 1311 100 Plus
CG11854-PB 250 CG11854-PB 1..249 2..248 371 34.4 Plus
to-PB 249 CG11853-PB 1..247 3..249 341 30.6 Plus
to-PA 249 CG11853-PA 1..247 3..249 341 30.6 Plus
CG10407-PB 259 CG10407-PB 31..256 19..246 313 30 Plus
CG10407-PA 259 CG10407-PA 31..256 19..246 313 30 Plus
CG10407-PC 263 CG10407-PC 31..260 19..246 301 29.5 Plus
CG31207-PA 258 CG31207-PA 23..248 23..248 298 28.9 Plus
CG7079-PB 255 CG7079-PB 23..249 23..248 291 29.6 Plus
CG7079-PA 255 CG7079-PA 23..249 23..248 291 29.6 Plus
CG17279-PD 245 CG17279-PD 4..243 9..247 281 28.8 Plus
CG13618-PA 252 CG13618-PA 8..251 1..248 256 28.3 Plus
CG31189-PB 258 CG31189-PB 17..249 15..248 250 24.7 Plus
CG2650-PA 260 CG2650-PA 8..257 1..247 243 26.6 Plus
CG10264-PA 270 CG10264-PA 76..262 52..240 241 31.4 Plus
CG14661-PB 246 CG14661-PB 1..244 2..247 231 28.3 Plus
CG14661-PA 246 CG14661-PA 1..244 2..247 231 28.3 Plus
CG14457-PB 271 CG14457-PB 11..244 9..238 210 26.5 Plus
CG14457-PC 270 CG14457-PC 11..243 9..238 209 26.2 Plus
CG1124-PA 246 CG1124-PA 22..246 23..249 191 24 Plus
CG2016-PD 249 CG2016-PD 28..244 25..245 190 21.6 Plus
CG2016-PB 249 CG2016-PB 28..244 25..245 190 21.6 Plus
CG14259-PA 289 CG14259-PA 18..260 1..238 190 25.9 Plus
CG17189-PC 271 CG17189-PC 7..245 1..242 187 24.5 Plus
CG17189-PB 271 CG17189-PB 7..245 1..242 187 24.5 Plus
CG2016-PE 254 CG2016-PE 28..249 25..245 174 21.1 Plus
CG2016-PC 183 CG2016-PC 20..178 85..245 166 22.2 Plus
CG14457-PA 144 CG14457-PA 3..117 124..238 153 30.4 Plus
CG33680-PA 278 CG33680-PA 106..227 126..247 151 26.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23924-PA 255 GI23924-PA 1..254 2..249 1048 77.2 Plus
Dmoj\GI23925-PA 241 GI23925-PA 6..241 9..249 382 34.4 Plus
Dmoj\GI23926-PA 238 GI23926-PA 1..237 11..249 377 35.1 Plus
Dmoj\GI10308-PA 253 GI10308-PA 6..250 6..250 334 27.6 Plus
Dmoj\GI10307-PA 256 GI10307-PA 1..251 1..250 294 30.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:46:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11987-PA 250 GL11987-PA 1..250 1..250 1138 82 Plus
Dper\GL11989-PA 256 GL11989-PA 26..255 19..248 366 33.2 Plus
Dper\GL12686-PA 243 GL12686-PA 5..243 4..249 334 32.4 Plus
Dper\GL12688-PA 258 GL12688-PA 23..248 23..248 322 27.8 Plus
Dper\GL11988-PA 251 GL11988-PA 9..245 11..247 316 28.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:46:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11236-PA 250 GA11236-PA 1..250 1..250 1138 82 Plus
Dpse\GA11238-PA 256 GA11238-PA 26..255 19..248 371 33.6 Plus
Dpse\GA16093-PA 258 GA16093-PA 23..248 23..248 320 27.8 Plus
Dpse\GA27589-PA 227 GA27589-PA 6..227 24..249 316 32.2 Plus
Dpse\GA11237-PA 251 GA11237-PA 9..245 11..247 316 28.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:46:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17820-PA 250 GM17820-PA 1..250 1..250 1322 98.4 Plus
Dsec\GM17823-PA 246 GM17823-PA 12..245 7..248 350 32.6 Plus
Dsec\GM17822-PA 249 GM17822-PA 1..247 3..249 342 30.6 Plus
Dsec\GM15112-PA 258 GM15112-PA 23..248 23..248 322 29.8 Plus
Dsec\GM25738-PA 230 GM25738-PA 1..228 22..247 305 29.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:46:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21189-PA 250 GD21189-PA 1..250 1..250 1329 99.2 Plus
Dsim\GD21191-PA 250 GD21191-PA 12..249 7..248 376 34.4 Plus
Dsim\GD20016-PA 258 GD20016-PA 23..248 23..248 322 29.8 Plus
Dsim\GD21190-PA 241 GD21190-PA 1..239 3..249 304 29 Plus
Dsim\GD20015-PA 255 GD20015-PA 4..251 6..250 281 27.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:46:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24016-PA 251 GJ24016-PA 1..251 2..250 1108 82.5 Plus
Dvir\GJ24018-PA 246 GJ24018-PA 7..246 9..249 418 33.2 Plus
Dvir\GJ24019-PA 245 GJ24019-PA 3..245 5..249 391 30.8 Plus
Dvir\GJ24020-PA 255 GJ24020-PA 15..252 14..247 371 33.6 Plus
Dvir\GJ10162-PA 257 GJ10162-PA 1..250 1..250 325 27.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:46:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13450-PA 250 GK13450-PA 1..250 1..250 1133 82.8 Plus
Dwil\GK13452-PA 254 GK13452-PA 7..253 1..249 369 31.7 Plus
Dwil\GK13451-PA 244 GK13451-PA 1..241 2..241 323 31 Plus
Dwil\GK14315-PA 258 GK14315-PA 4..248 3..248 312 29.4 Plus
Dwil\GK14313-PA 240 GK14313-PA 1..219 25..243 311 28.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23575-PA 251 GE23575-PA 2..251 1..250 1302 96.8 Plus
Dyak\GE23577-PA 250 GE23577-PA 1..249 2..248 393 35.5 Plus
Dyak\to-PA 248 GE23576-PA 1..247 3..249 360 31.9 Plus
Dyak\GE25023-PA 258 GE25023-PA 23..248 23..248 312 29.8 Plus
Dyak\GE26341-PA 259 GE26341-PA 31..257 19..247 305 29 Plus