Clone LP07781 Report

Search the DGRC for LP07781

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:77
Well:81
Vector:pOT2
Associated Gene/TranscriptCG17819-RA
Protein status:LP07781.pep: gold
Preliminary Size:644
Sequenced Size:664

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17819 2002-01-01 Sim4 clustering to Release 2
CG17819 2002-05-18 Blastp of sequenced clone
CG17819 2003-01-01 Sim4 clustering to Release 3
CG17819 2008-04-29 Release 5.5 accounting
CG17819 2008-08-15 Release 5.9 accounting
CG17819 2008-12-18 5.12 accounting

Clone Sequence Records

LP07781.complete Sequence

664 bp (664 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119065

> LP07781.complete
CAAATTTCGATCCCCATGTGTTTTTACGGACCTGTTTCGTTCATAAAAAA
GATCCTGCCCGCAGGCTCTCAGAAATCATGTCTGCTCATTTTAGGATTAG
ACAATGCGGGAAAATCCACGTTGACAGACCGCCTGGCGGAAATTTTCAAT
GGAGAATCCAAGGAATCTAACAATCAAGTTAGTGAATGGAGCTTCACCAT
AAATAATTTCAGAGTCCAGTTGTGGGATATTAACGGAGAACTGAAGAATC
GCCAGATCTGGCCAAAGTATTATAAGAAAGTGAATGTTTTGATTTTTGTA
CTGGATAGCACGGATGCACTGCGGCTAAGCGAGGCGCGATGTGTTTTATG
CGATGTTTTGATGCACCAGGAACTGGATAATGCTCCGCTGCTGATCGTGT
CCAACAAGAAGGACGCCTCGGGATCCCTGTCCATGTCCACGGTTATCGAT
TTGATGGGCCTATATCGCCTAACTGGTCGAGATTGGACTTTTGAGGAATG
TTCCATGCGGACAGGGTCTGGTGTTCAGGAGATCGTAAATTGGATTAACG
AAAAGATCAACAATAACAGGAAGTGATTTATCACATTTTTATATTTTCAA
AAATTTGGCAACCTATTAACTAATATATTAAATATATATTTAATGTAAAA
AAAAAAAAAAAAAA

LP07781.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:01:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG17819-RA 718 CG17819-RA 56..703 1..648 3240 100 Plus
CG17819.b 780 CG17819.b 274..765 157..648 2460 100 Plus
CG17819.a 679 CG17819.a 173..664 157..648 2460 100 Plus
CG17819.b 780 CG17819.b 56..211 1..156 780 100 Plus
CG17819.a 679 CG17819.a 1..156 1..156 780 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17708618..17708856 529..291 1165 99.2 Minus
chr3R 27901430 chr3R 17709110..17709265 156..1 780 100 Minus
chr3R 27901430 chr3R 17708913..17709047 291..157 660 99.3 Minus
chr3R 27901430 chr3R 17708444..17708563 646..527 555 97.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:52:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21884902..21885140 529..291 1195 100 Minus
3R 32079331 3R 21885395..21885550 156..1 780 100 Minus
3R 32079331 3R 21885198..21885332 291..157 675 100 Minus
3R 32079331 3R 21884726..21884847 648..527 610 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:33:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21625733..21625971 529..291 1195 100 Minus
3R 31820162 3R 21626226..21626381 156..1 780 100 Minus
3R 31820162 3R 21626029..21626163 291..157 675 100 Minus
3R 31820162 3R 21625557..21625678 648..527 610 100 Minus
Blast to na_te.dros performed on 2019-03-16 11:20:49 has no hits.

LP07781.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:21:25 Download gff for LP07781.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17708444..17708561 529..646 97 <- Minus
chr3R 17708619..17708855 292..528 99 <- Minus
chr3R 17708913..17709047 157..291 99 <- Minus
chr3R 17709110..17709265 1..156 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:38:39 Download gff for LP07781.complete
Subject Subject Range Query Range Percent Splice Strand
CG17819-RA 1..561 16..576 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:42:17 Download gff for LP07781.complete
Subject Subject Range Query Range Percent Splice Strand
CG17819-RA 1..561 16..576 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:23:35 Download gff for LP07781.complete
Subject Subject Range Query Range Percent Splice Strand
CG17819-RA 1..561 16..576 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:34:24 Download gff for LP07781.complete
Subject Subject Range Query Range Percent Splice Strand
CG17819-RA 1..561 16..576 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:13:27 Download gff for LP07781.complete
Subject Subject Range Query Range Percent Splice Strand
CG17819-RA 1..561 16..576 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:16:33 Download gff for LP07781.complete
Subject Subject Range Query Range Percent Splice Strand
CG17819-RA 1..646 1..646 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:42:17 Download gff for LP07781.complete
Subject Subject Range Query Range Percent Splice Strand
CG17819-RA 1..646 1..646 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:23:35 Download gff for LP07781.complete
Subject Subject Range Query Range Percent Splice Strand
CG17819-RA 1..646 1..646 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:34:24 Download gff for LP07781.complete
Subject Subject Range Query Range Percent Splice Strand
CG17819-RA 1..646 1..646 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:13:27 Download gff for LP07781.complete
Subject Subject Range Query Range Percent Splice Strand
CG17819-RA 1..646 1..646 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:21:25 Download gff for LP07781.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21885395..21885550 1..156 100   Minus
3R 21885198..21885332 157..291 100 <- Minus
3R 21884728..21884845 529..646 100 <- Minus
3R 21884903..21885139 292..528 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:21:25 Download gff for LP07781.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21885395..21885550 1..156 100   Minus
3R 21885198..21885332 157..291 100 <- Minus
3R 21884728..21884845 529..646 100 <- Minus
3R 21884903..21885139 292..528 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:21:25 Download gff for LP07781.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21885395..21885550 1..156 100   Minus
3R 21885198..21885332 157..291 100 <- Minus
3R 21884728..21884845 529..646 100 <- Minus
3R 21884903..21885139 292..528 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:23:35 Download gff for LP07781.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17710450..17710567 529..646 100 <- Minus
arm_3R 17710625..17710861 292..528 100 <- Minus
arm_3R 17710920..17711054 157..291 100 <- Minus
arm_3R 17711117..17711272 1..156 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:06:44 Download gff for LP07781.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21625734..21625970 292..528 100 <- Minus
3R 21626029..21626163 157..291 100 <- Minus
3R 21626226..21626381 1..156 100   Minus
3R 21625559..21625676 529..646 100 <- Minus

LP07781.hyp Sequence

Translation from 0 to 575

> LP07781.hyp
QISIPMCFYGPVSFIKKILPAGSQKSCLLILGLDNAGKSTLTDRLAEIFN
GESKESNNQVSEWSFTINNFRVQLWDINGELKNRQIWPKYYKKVNVLIFV
LDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSLSMSTVID
LMGLYRLTGRDWTFEECSMRTGSGVQEIVNWINEKINNNRK*

LP07781.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:26:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG17819-PA 186 CG17819-PA 1..186 6..191 972 100 Plus
dnd-PA 179 CG6560-PA 2..173 10..182 294 34.8 Plus
Arf79F-PJ 182 CG8385-PJ 14..179 22..188 245 33.9 Plus
Arf79F-PI 182 CG8385-PI 14..179 22..188 245 33.9 Plus
Arf79F-PH 182 CG8385-PH 14..179 22..188 245 33.9 Plus

LP07781.pep Sequence

Translation from 15 to 575

> LP07781.pep
MCFYGPVSFIKKILPAGSQKSCLLILGLDNAGKSTLTDRLAEIFNGESKE
SNNQVSEWSFTINNFRVQLWDINGELKNRQIWPKYYKKVNVLIFVLDSTD
ALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSLSMSTVIDLMGLY
RLTGRDWTFEECSMRTGSGVQEIVNWINEKINNNRK*

LP07781.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:14:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16956-PA 183 GF16956-PA 1..183 1..183 685 66.7 Plus
Dana\GF16955-PA 184 GF16955-PA 5..178 3..177 307 35.8 Plus
Dana\GF23441-PA 182 GF23441-PA 14..179 17..183 244 33.9 Plus
Dana\GF23565-PA 179 GF23565-PA 13..178 17..183 234 31.2 Plus
Dana\GF24106-PA 180 GF24106-PA 3..180 5..185 225 29 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12550-PA 186 GG12550-PA 1..186 1..186 860 87.1 Plus
Dere\GG12548-PA 179 GG12548-PA 2..173 5..177 300 35.6 Plus
Dere\GG13164-PA 182 GG13164-PA 14..179 17..183 244 33.9 Plus
Dere\GG15097-PA 179 GG15097-PA 13..178 17..183 235 31.2 Plus
Dere\GG15940-PA 190 GG15940-PA 13..190 5..185 225 29 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19912-PA 199 GH19912-PA 10..185 8..181 346 41.1 Plus
Dgri\GH19902-PA 183 GH19902-PA 12..177 11..177 282 34.1 Plus
Dgri\GH14762-PA 182 GH14762-PA 14..179 17..183 244 33.9 Plus
Dgri\GH15973-PA 179 GH15973-PA 13..178 17..183 233 30 Plus
Dgri\GH14763-PA 182 GH14763-PA 14..182 17..186 227 30 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG17819-PA 186 CG17819-PA 1..186 1..186 972 100 Plus
dnd-PA 179 CG6560-PA 2..173 5..177 294 34.8 Plus
Arf79F-PJ 182 CG8385-PJ 14..179 17..183 245 33.9 Plus
Arf79F-PI 182 CG8385-PI 14..179 17..183 245 33.9 Plus
Arf79F-PH 182 CG8385-PH 14..179 17..183 245 33.9 Plus
Arf79F-PF 182 CG8385-PF 14..179 17..183 245 33.9 Plus
Arf79F-PC 182 CG8385-PC 14..179 17..183 245 33.9 Plus
Arf79F-PE 182 CG8385-PE 14..179 17..183 245 33.9 Plus
Arf79F-PB 182 CG8385-PB 14..179 17..183 245 33.9 Plus
Arf79F-PA 182 CG8385-PA 14..179 17..183 245 33.9 Plus
Arl5-PA 179 CG7197-PA 13..178 17..183 243 31.2 Plus
Arl1-PA 180 CG6025-PA 3..180 5..185 230 28.7 Plus
Arl2-PA 184 CG7435-PA 19..172 23..177 219 30.4 Plus
Arf51F-PE 175 CG8156-PE 10..169 17..177 216 31.3 Plus
Arf51F-PA 175 CG8156-PA 10..169 17..177 216 31.3 Plus
Arf51F-PC 175 CG8156-PC 10..169 17..177 216 31.3 Plus
Arf51F-PB 175 CG8156-PB 10..169 17..177 216 31.3 Plus
Arf51F-PD 175 CG8156-PD 10..169 17..177 216 31.3 Plus
Sar1-PE 193 CG7073-PE 23..193 23..182 215 31.4 Plus
Sar1-PC 193 CG7073-PC 23..193 23..182 215 31.4 Plus
Sar1-PD 193 CG7073-PD 23..193 23..182 215 31.4 Plus
Sar1-PA 193 CG7073-PA 23..193 23..182 215 31.4 Plus
Arf102F-PB 180 CG11027-PB 14..177 17..181 214 31.4 Plus
Arf102F-PA 180 CG11027-PA 14..177 17..181 214 31.4 Plus
Arfrp1-PA 200 CG7039-PA 19..190 22..184 206 28.9 Plus
Arl6-PB 201 CG7735-PB 2..182 5..181 183 25.9 Plus
Arl6-PA 202 CG7735-PA 2..183 5..181 182 25.8 Plus
Arl8-PC 186 CG7891-PC 23..177 23..177 177 25.2 Plus
Arl8-PB 186 CG7891-PB 23..177 23..177 177 25.2 Plus
Arl8-PA 186 CG7891-PA 23..177 23..177 177 25.2 Plus
Arl4-PB 313 CG2219-PB 19..189 14..183 153 26.8 Plus
Arl4-PA 312 CG2219-PA 27..188 23..183 152 27 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22039-PA 169 GI22039-PA 3..164 8..170 342 42.3 Plus
Dmoj\GI22038-PA 437 GI22038-PA 260..431 5..177 303 35.6 Plus
Dmoj\GI11864-PA 182 GI11864-PA 14..179 17..183 244 33.9 Plus
Dmoj\GI16622-PA 179 GI16622-PA 13..178 17..183 235 30.6 Plus
Dmoj\GI11881-PA 180 GI11881-PA 3..180 5..185 224 29 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23730-PA 183 GL23730-PA 1..181 1..181 532 54.7 Plus
Dper\GL23729-PA 182 GL23729-PA 15..176 15..177 284 35.4 Plus
Dper\GL25178-PA 182 GL25178-PA 14..179 17..183 244 33.9 Plus
Dper\GL22555-PA 179 GL22555-PA 13..178 17..183 235 31.2 Plus
Dper\GL17751-PA 175 GL17751-PA 10..170 17..178 227 32.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14680-PA 183 GA14680-PA 1..181 1..181 538 55.2 Plus
Dpse\GA19685-PA 182 GA19685-PA 15..176 15..177 284 35.4 Plus
Dpse\GA21036-PA 182 GA21036-PA 14..179 17..183 244 33.9 Plus
Dpse\GA20174-PA 179 GA20174-PA 13..178 17..183 235 31.2 Plus
Dpse\GA20856-PA 175 GA20856-PA 10..170 17..178 227 32.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23683-PA 186 GM23683-PA 1..185 1..185 939 95.7 Plus
Dsec\GM23682-PA 179 GM23682-PA 2..173 5..177 297 35.1 Plus
Dsec\GM22073-PA 182 GM22073-PA 14..179 17..183 244 33.9 Plus
Dsec\GM24953-PA 179 GM24953-PA 13..178 17..183 235 31.2 Plus
Dsec\GM25571-PA 180 GM25571-PA 3..180 5..185 225 29 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18492-PA 186 GD18492-PA 1..186 1..186 931 94.1 Plus
Dsim\GD18491-PA 179 GD18491-PA 2..173 5..177 297 35.1 Plus
Dsim\GD12049-PA 182 GD12049-PA 14..179 17..183 244 33.9 Plus
Dsim\GD13004-PA 179 GD13004-PA 13..178 17..183 235 31.2 Plus
Dsim\GD14586-PA 180 GD14586-PA 3..180 5..185 225 29 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24092-PA 192 GJ24092-PA 5..175 3..171 363 43.3 Plus
Dvir\GJ24091-PA 179 GJ24091-PA 2..173 5..177 306 36.2 Plus
Dvir\GJ13559-PA 182 GJ13559-PA 14..179 17..183 244 33.9 Plus
Dvir\GJ12878-PA 179 GJ12878-PA 13..178 17..183 233 30 Plus
Dvir\GJ13575-PA 180 GJ13575-PA 3..180 5..185 225 29 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13012-PA 172 GK13012-PA 1..171 1..171 345 40.8 Plus
Dwil\GK13011-PA 193 GK13011-PA 22..187 11..177 294 35.7 Plus
Dwil\GK20496-PA 182 GK20496-PA 14..179 17..183 244 33.9 Plus
Dwil\GK17000-PA 179 GK17000-PA 13..178 17..183 234 31.2 Plus
Dwil\GK20891-PA 175 GK20891-PA 10..170 17..178 222 31.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24075-PA 186 GE24075-PA 1..186 1..186 847 85.5 Plus
Dyak\GE24074-PA 179 GE24074-PA 2..173 5..177 298 35.6 Plus
Dyak\GE19486-PA 182 GE19486-PA 14..179 17..183 244 33.9 Plus
Dyak\GE21319-PA 179 GE21319-PA 13..178 17..183 235 31.2 Plus
Dyak\GE22880-PA 180 GE22880-PA 3..180 5..185 225 29 Plus